BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0856 (740 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY043292-1|AAK96031.1| 323|Tribolium castaneum homeodomain tran... 23 2.0 AF228509-1|AAF69136.1| 325|Tribolium castaneum prothoraxless pr... 23 2.0 AJ606487-1|CAE55183.1| 203|Tribolium castaneum Giant protein pr... 23 2.6 AJ307577-1|CAC84070.1| 301|Tribolium castaneum dachshund protein. 22 6.0 AY884064-1|AAX84205.1| 683|Tribolium castaneum pro-phenol oxida... 21 7.9 >AY043292-1|AAK96031.1| 323|Tribolium castaneum homeodomain transcription factor Prothoraxlessprotein. Length = 323 Score = 23.4 bits (48), Expect = 2.0 Identities = 21/79 (26%), Positives = 34/79 (43%), Gaps = 4/79 (5%) Frame = +2 Query: 50 HHPRHQGRQGCRPAVRIGRRMHHPGSGRPRPAL-RPVQEGRLPLRQVALRAEDWPQHPLV 226 HH H +Q + G MH G +P + + +G+ P A A P +P + Sbjct: 178 HHQPHHQQQHMMYGGQQGANMHQQGPPHQQPPIQQQPNQGQQPPGNTA-AALPSPLYPWM 236 Query: 227 PS-YPGK--RQCFARYASI 274 S + K RQ + RY ++ Sbjct: 237 RSQFERKRGRQTYTRYQTL 255 >AF228509-1|AAF69136.1| 325|Tribolium castaneum prothoraxless protein. Length = 325 Score = 23.4 bits (48), Expect = 2.0 Identities = 21/79 (26%), Positives = 34/79 (43%), Gaps = 4/79 (5%) Frame = +2 Query: 50 HHPRHQGRQGCRPAVRIGRRMHHPGSGRPRPAL-RPVQEGRLPLRQVALRAEDWPQHPLV 226 HH H +Q + G MH G +P + + +G+ P A A P +P + Sbjct: 180 HHQPHHQQQHMMYGGQQGANMHQQGPPHQQPPIQQQPNQGQQPPGNTA-AALPSPLYPWM 238 Query: 227 PS-YPGK--RQCFARYASI 274 S + K RQ + RY ++ Sbjct: 239 RSQFERKRGRQTYTRYQTL 257 >AJ606487-1|CAE55183.1| 203|Tribolium castaneum Giant protein protein. Length = 203 Score = 23.0 bits (47), Expect = 2.6 Identities = 7/16 (43%), Positives = 12/16 (75%) Frame = +3 Query: 129 DDLAQRCAQYKKDGCH 176 D++A RCA +++ CH Sbjct: 161 DEIAIRCAFLERENCH 176 >AJ307577-1|CAC84070.1| 301|Tribolium castaneum dachshund protein. Length = 301 Score = 21.8 bits (44), Expect = 6.0 Identities = 10/27 (37%), Positives = 13/27 (48%) Frame = +3 Query: 597 RYQRCGPQEALGSDVQLRARPPGFGAP 677 R +RC P L D + R P G+P Sbjct: 181 REERCDPDRPLPLDQKARDLSPRNGSP 207 >AY884064-1|AAX84205.1| 683|Tribolium castaneum pro-phenol oxidase subunit 2 protein. Length = 683 Score = 21.4 bits (43), Expect = 7.9 Identities = 6/8 (75%), Positives = 7/8 (87%) Frame = +2 Query: 206 WPQHPLVP 229 WPQH L+P Sbjct: 582 WPQHMLIP 589 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 172,439 Number of Sequences: 336 Number of extensions: 4084 Number of successful extensions: 15 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 19884055 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -