Bombyx BLAST Result against fruitfly

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= mg--0854
         (558 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AE013599-2072|AAM70976.1|  733|Drosophila melanogaster CG30471-P...    28   7.4  

>AE013599-2072|AAM70976.1|  733|Drosophila melanogaster CG30471-PA
           protein.
          Length = 733

 Score = 28.3 bits (60), Expect = 7.4
 Identities = 22/68 (32%), Positives = 32/68 (47%)
 Frame = -2

Query: 506 NLLMTSWATYSRTRLTSAA*SVR*TGIFSRKLLTAGPTSRPKRLIWRLDLTSPIVIAAPM 327
           +L +   A +S T       S   TG++  +LL A       RL + + L +P+VIA   
Sbjct: 619 SLFVLGRALFSLTICWMIVGSASGTGVWWSRLLEAKFFQHLNRLSYAIYLLNPLVIALVY 678

Query: 326 SLTMMLSA 303
           SLT   SA
Sbjct: 679 SLTSTSSA 686


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 21,940,745
Number of Sequences: 53049
Number of extensions: 415275
Number of successful extensions: 1361
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1307
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1361
length of database: 24,988,368
effective HSP length: 81
effective length of database: 20,691,399
effective search space used: 2151905496
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)