BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0851 (806 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g57660.1 68416.m06424 DNA-directed RNA polymerase family prot... 31 0.68 At3g55700.1 68416.m06188 UDP-glucoronosyl/UDP-glucosyl transfera... 31 0.90 At1g25540.1 68414.m03171 phytochrome and flowering time regulato... 31 0.90 At5g31412.1 68418.m03722 hypothetical protein contains Pfam doma... 31 1.2 At4g25940.1 68417.m03731 epsin N-terminal homology (ENTH) domain... 30 2.1 At4g21450.2 68417.m03102 vesicle-associated membrane family prot... 30 2.1 At4g21450.1 68417.m03103 vesicle-associated membrane family prot... 30 2.1 At5g14280.1 68418.m01670 DNA-binding storekeeper protein-related... 29 2.7 At2g45000.1 68415.m05603 expressed protein contains Pfam profile... 29 2.7 At5g62580.1 68418.m07855 expressed protein 29 3.6 At5g51200.1 68418.m06349 expressed protein 28 8.4 At3g20540.1 68416.m02600 DNA-directed DNA polymerase family prot... 28 8.4 At1g56520.1 68414.m06499 disease resistance protein (TIR-NBS-LRR... 28 8.4 >At3g57660.1 68416.m06424 DNA-directed RNA polymerase family protein similar to SP|O35134 DNA-directed RNA polymerase I largest subunit (EC 2.7.7.6) (RNA polymerase I 194 kDa subunit) (RPA194) {Mus musculus}; contains InterPro accession IPR000722: RNA polymerase, alpha subunit Length = 1670 Score = 31.5 bits (68), Expect = 0.68 Identities = 25/96 (26%), Positives = 41/96 (42%), Gaps = 3/96 (3%) Frame = +1 Query: 496 HRG*TVEKTNEEIENDSEVGSISWVEYPAELDEDGNGLVIVDLPIEAQPEDLEKAQLVDL 675 H T E +ND S+S + + D+DG G + DL +AQ + ++ +D Sbjct: 1314 HNDVTGPIAGNETDNDD---SVSGKQNEDDGDDDGEGTEVDDLGSDAQKQKKQETDEMDY 1370 Query: 676 ---PVENVAEPEDLSPVQVVNPIVENSQSEYPAKDT 774 + EP +S V+ EN +E +DT Sbjct: 1371 EENSEDETNEPSSISGVEDPEMDSENEDTEVSKEDT 1406 >At3g55700.1 68416.m06188 UDP-glucoronosyl/UDP-glucosyl transferase family protein glucuronosyl transferase homolog, Lycopersicon esculentum, PIR:S39507 ;contains Pfam profile: PF00201 UDP-glucoronosyl and UDP-glucosyl transferase Length = 460 Score = 31.1 bits (67), Expect = 0.90 Identities = 23/68 (33%), Positives = 36/68 (52%), Gaps = 1/68 (1%) Frame = +1 Query: 553 GSISWVEYPA-ELDEDGNGLVIVDLPIEAQPEDLEKAQLVDLPVENVAEPEDLSPVQVVN 729 G+ S+ + A L D L I D ++ +L ++ DLPV EPE+L +VVN Sbjct: 141 GASSFCAFAAFPLLRDKGYLPIQDSRLDEPVTELPPLKVKDLPVMETNEPEEL--YRVVN 198 Query: 730 PIVENSQS 753 +VE ++S Sbjct: 199 DMVEGAKS 206 >At1g25540.1 68414.m03171 phytochrome and flowering time regulatory protein (PFT1) PMID: 12815435 Length = 836 Score = 31.1 bits (67), Expect = 0.90 Identities = 20/83 (24%), Positives = 36/83 (43%), Gaps = 4/83 (4%) Frame = -1 Query: 503 PRCSQGRLVNRRPQLEHRRCLRS*QNQPGH----RRPQLEHRRCLRSLQNQPGHRRPQLE 336 P Q + Q + ++ ++ Q Q H + PQL+ ++ Q Q H+ QL+ Sbjct: 679 PNQQQQQQQQLHQQQQQQQQIQQQQQQQQHLQQQQMPQLQQQQQQHQQQQQQQHQLSQLQ 738 Query: 335 HRGFLRSLQSQPGNRHSQLELRH 267 H + Q Q +H +L+H Sbjct: 739 HHQQQQQQQQQQQQQHQLTQLQH 761 >At5g31412.1 68418.m03722 hypothetical protein contains Pfam domain, PF04937: Protein of unknown function (DUF 659) Length = 433 Score = 30.7 bits (66), Expect = 1.2 Identities = 17/51 (33%), Positives = 26/51 (50%) Frame = +1 Query: 571 EYPAELDEDGNGLVIVDLPIEAQPEDLEKAQLVDLPVENVAEPEDLSPVQV 723 E P+E DE+ NG + P E EDLE + D+ ++ E ++ V V Sbjct: 375 EGPSERDEEPNGEPVYQTPNEKPREDLESHEEHDITIDIEFESDNEQVVNV 425 >At4g25940.1 68417.m03731 epsin N-terminal homology (ENTH) domain-containing protein contains Pfam PF01417: ENTH domain. ENTH (Epsin N-terminal homology) domain; similar to Chain B, Crystal Structure Of N-Terminal Domain Of Drosophila Ap180 (GP:13399617) [Drosophila melanogaster]; supporting cDNA gi|20465326|gb|AY096427.1| Length = 601 Score = 29.9 bits (64), Expect = 2.1 Identities = 22/73 (30%), Positives = 31/73 (42%) Frame = +1 Query: 514 EKTNEEIENDSEVGSISWVEYPAELDEDGNGLVIVDLPIEAQPEDLEKAQLVDLPVENVA 693 EK EE E + S+ E PAE D IE + ED EK + D + Sbjct: 331 EKEEEEQEEEEAEHSVQ-PEEPAEADNQKENSEGDQPLIEEEEEDQEKIEEEDAKPSFLI 389 Query: 694 EPEDLSPVQVVNP 732 + +DL + +NP Sbjct: 390 DTDDLLGLNEINP 402 >At4g21450.2 68417.m03102 vesicle-associated membrane family protein / VAMP family protein similar to VAP27 GI:6688926 [Nicotiana plumbaginifolia] Length = 212 Score = 29.9 bits (64), Expect = 2.1 Identities = 14/32 (43%), Positives = 19/32 (59%) Frame = -1 Query: 656 FSKSSGCASIGRSTITSPFPSSSNSAGYSTQL 561 F SSG + S TSPFPS ++S+ S+ L Sbjct: 23 FRNSSGHRNAASSAATSPFPSGASSSSTSSHL 54 >At4g21450.1 68417.m03103 vesicle-associated membrane family protein / VAMP family protein similar to VAP27 GI:6688926 [Nicotiana plumbaginifolia] Length = 295 Score = 29.9 bits (64), Expect = 2.1 Identities = 14/32 (43%), Positives = 19/32 (59%) Frame = -1 Query: 656 FSKSSGCASIGRSTITSPFPSSSNSAGYSTQL 561 F SSG + S TSPFPS ++S+ S+ L Sbjct: 23 FRNSSGHRNAASSAATSPFPSGASSSSTSSHL 54 >At5g14280.1 68418.m01670 DNA-binding storekeeper protein-related contains similarity to storekeeper protein [Solanum tuberosum] gi|14268476|emb|CAC39398; contains PF04504: Protein of unknown function, DUF573 Length = 572 Score = 29.5 bits (63), Expect = 2.7 Identities = 13/39 (33%), Positives = 20/39 (51%) Frame = +1 Query: 514 EKTNEEIENDSEVGSISWVEYPAELDEDGNGLVIVDLPI 630 E N++ + S +SWVE P + + + I DLPI Sbjct: 295 EAANDDYSSSSSSSIVSWVEIPISMSINIGEISIPDLPI 333 >At2g45000.1 68415.m05603 expressed protein contains Pfam profile: PF05064 Nsp1-like C-terminal region Length = 739 Score = 29.5 bits (63), Expect = 2.7 Identities = 22/50 (44%), Positives = 28/50 (56%), Gaps = 2/50 (4%) Frame = -1 Query: 704 SSGSATFSTGRSTSW--AFSKSSGCASIGRSTITSPFPSSSNSAGYSTQL 561 SS S +TG S S+ A S S SI +T +SPF SS+SAG + L Sbjct: 243 SSSSIFGATGSSPSFSVASSASGSSPSIFGATGSSPFFGSSSSAGSTPSL 292 >At5g62580.1 68418.m07855 expressed protein Length = 615 Score = 29.1 bits (62), Expect = 3.6 Identities = 16/35 (45%), Positives = 19/35 (54%) Frame = +1 Query: 55 HQSNPSKSRISQYRNTKASTLECTSSPTKSFKNSP 159 H S S SR+S YRN A T E +S + F SP Sbjct: 541 HDSKYSASRMSTYRNRNAETTEIQNSRHR-FNGSP 574 >At5g51200.1 68418.m06349 expressed protein Length = 1808 Score = 27.9 bits (59), Expect = 8.4 Identities = 22/76 (28%), Positives = 36/76 (47%), Gaps = 2/76 (2%) Frame = +3 Query: 90 IPKYESIDAGMYIIPD-EVIQELALAGIELSEN-VDNVAIFDIEIPVDNVDFPVDSVTS* 263 +P IDA +I D E L E+ EN D++ + +++ VDN++ P S+T Sbjct: 825 VPMLIKIDAANSLIEDYAACLEGRLEEGEVVENSCDDLGVLIMQLLVDNINRPAPSITH- 883 Query: 264 KMSKLQLRMPISRLTL 311 + K L P+ L Sbjct: 884 LLLKFDLDAPVEGTVL 899 >At3g20540.1 68416.m02600 DNA-directed DNA polymerase family protein similar to PolI-like DNA polymerase [Oryza sativa] GI:19912795; contains Pfam profiles PF01612: 3'-5' exonuclease, PF00476: DNA polymerase I family A Length = 1034 Score = 27.9 bits (59), Expect = 8.4 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +1 Query: 73 KSRISQYRNTKASTLECTSSPTKSFKNSPWPGLN 174 K R +++RN K + PT+ F S WP ++ Sbjct: 590 KKRATKFRNIKLHRISDRPLPTEKFTASGWPSVS 623 >At1g56520.1 68414.m06499 disease resistance protein (TIR-NBS-LRR class), putative domain signature TIR-NBS-LRR exists, suggestive of a disease resistance protein. Length = 897 Score = 27.9 bits (59), Expect = 8.4 Identities = 12/37 (32%), Positives = 23/37 (62%) Frame = -2 Query: 427 ISRDIGVLNWSIDVVYEVYRISQDIGVLNWSIEVFYE 317 +S++ +WS+D + E+ + +DIG + + VFYE Sbjct: 73 LSKNYASSSWSLDELLEILKCKEDIGQI--VMTVFYE 107 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,593,424 Number of Sequences: 28952 Number of extensions: 350709 Number of successful extensions: 1314 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 1235 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1312 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1833827200 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -