BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= mg--0850
(823 letters)
Database: uniref50
1,657,284 sequences; 575,637,011 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
UniRef50_Q6U7X0 Cluster: Putative uncharacterized protein hyp20;... 34 3.7
>UniRef50_Q6U7X0 Cluster: Putative uncharacterized protein hyp20;
n=1; Moniliophthora perniciosa|Rep: Putative
uncharacterized protein hyp20 - Crinipellis perniciosa
(Witches'-broom disease fungus) (Marasmiusperniciosus)
Length = 251
Score = 34.3 bits (75), Expect = 3.7
Identities = 17/45 (37%), Positives = 28/45 (62%)
Frame = -3
Query: 635 FYYIKQLFAYIKKSYSRLIYISASVKINNLLTVIN*LSLGNRIMK 501
+Y + QLF + SY+ LI+ + K+NN+L+ I L + N I+K
Sbjct: 159 YYQLFQLFFTLSLSYNLLIFYVSEEKLNNILSKILPLKIVNYILK 203
Database: uniref50
Posted date: Oct 5, 2007 11:19 AM
Number of letters in database: 575,637,011
Number of sequences in database: 1,657,284
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 661,214,551
Number of Sequences: 1657284
Number of extensions: 11769694
Number of successful extensions: 19559
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 18983
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 19554
length of database: 575,637,011
effective HSP length: 100
effective length of database: 409,908,611
effective search space used: 70914189703
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -