BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0850 (823 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q6U7X0 Cluster: Putative uncharacterized protein hyp20;... 34 3.7 >UniRef50_Q6U7X0 Cluster: Putative uncharacterized protein hyp20; n=1; Moniliophthora perniciosa|Rep: Putative uncharacterized protein hyp20 - Crinipellis perniciosa (Witches'-broom disease fungus) (Marasmiusperniciosus) Length = 251 Score = 34.3 bits (75), Expect = 3.7 Identities = 17/45 (37%), Positives = 28/45 (62%) Frame = -3 Query: 635 FYYIKQLFAYIKKSYSRLIYISASVKINNLLTVIN*LSLGNRIMK 501 +Y + QLF + SY+ LI+ + K+NN+L+ I L + N I+K Sbjct: 159 YYQLFQLFFTLSLSYNLLIFYVSEEKLNNILSKILPLKIVNYILK 203 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 661,214,551 Number of Sequences: 1657284 Number of extensions: 11769694 Number of successful extensions: 19559 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 18983 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 19554 length of database: 575,637,011 effective HSP length: 100 effective length of database: 409,908,611 effective search space used: 70914189703 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -