BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0848 (809 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ370038-1|ABD18599.1| 122|Anopheles gambiae putative TIL domai... 25 3.7 AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. 23 8.4 >DQ370038-1|ABD18599.1| 122|Anopheles gambiae putative TIL domain polypeptide protein. Length = 122 Score = 24.6 bits (51), Expect = 3.7 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = +2 Query: 698 CCMGQVRQHKTGGNCLRSSCY 760 C G VR++ GG C+R Y Sbjct: 62 CEKGYVREYLDGGKCVRPDTY 82 >AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. Length = 3361 Score = 23.4 bits (48), Expect = 8.4 Identities = 9/41 (21%), Positives = 20/41 (48%) Frame = -2 Query: 481 YSLHVCEMIFMVLNQYYKIAIFIKFPPDAELRFVKFEFHSH 359 Y HV E +++ + ++ PD +L++ ++H H Sbjct: 71 YPWHVYEPSSLIVRSSKGVEVYQWNKPDLKLQYTVSKYHDH 111 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 780,701 Number of Sequences: 2352 Number of extensions: 14823 Number of successful extensions: 12 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 85655418 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -