BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0844 (410 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ000307-1|AAY21180.1| 423|Apis mellifera major royal jelly pro... 21 7.2 AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 21 7.2 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 21 7.2 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 20 9.5 >DQ000307-1|AAY21180.1| 423|Apis mellifera major royal jelly protein 9 protein. Length = 423 Score = 20.6 bits (41), Expect = 7.2 Identities = 8/34 (23%), Positives = 19/34 (55%) Frame = +1 Query: 166 SGKSRALPTQTYIPCSRSHQPLHVVSLPHRVCLS 267 SG++ P+Q + ++ + L V +PH + ++ Sbjct: 144 SGETSVCPSQIVVFDLKNSKLLKQVKIPHDIAIN 177 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 20.6 bits (41), Expect = 7.2 Identities = 9/22 (40%), Positives = 13/22 (59%) Frame = -2 Query: 259 ILDVAGRRHVGVDATVSTVCTS 194 IL+ +G HV D + S VC + Sbjct: 240 ILENSGVVHVAQDESTSLVCVA 261 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 20.6 bits (41), Expect = 7.2 Identities = 9/22 (40%), Positives = 13/22 (59%) Frame = -2 Query: 259 ILDVAGRRHVGVDATVSTVCTS 194 IL+ +G HV D + S VC + Sbjct: 240 ILENSGVVHVAQDESTSLVCVA 261 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 20.2 bits (40), Expect = 9.5 Identities = 8/16 (50%), Positives = 10/16 (62%) Frame = +2 Query: 200 TYRAHGRINPYMSSPC 247 T +AH R+ P SS C Sbjct: 64 TAQAHHRLYPAFSSSC 79 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 105,103 Number of Sequences: 438 Number of extensions: 1921 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 52 effective length of database: 123,567 effective search space used: 10379628 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -