BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0843 (368 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_30883| Best HMM Match : F5_F8_type_C (HMM E-Value=9.4e-30) 29 1.6 SB_6080| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 8.3 >SB_30883| Best HMM Match : F5_F8_type_C (HMM E-Value=9.4e-30) Length = 679 Score = 28.7 bits (61), Expect = 1.6 Identities = 18/55 (32%), Positives = 26/55 (47%), Gaps = 2/55 (3%) Frame = +2 Query: 92 FFQSYFF*HATIVHFPKGPYIIVPSIYDRWRSIYVCLSEL--HNLHTFIKIPLVT 250 FF + H + + K YI + + R R IYV L E+ H L F +P+ T Sbjct: 181 FFDRLRYVHLSTLKVFKNRYIFIYYVQSRLREIYVTLFEIGAHVLPCFRVMPVAT 235 >SB_6080| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2101 Score = 26.2 bits (55), Expect = 8.3 Identities = 8/25 (32%), Positives = 15/25 (60%) Frame = -2 Query: 163 WYYDIRTFRKMYNCSMLKKIRLEKL 89 W YD F K+Y C K ++++++ Sbjct: 1907 WTYDNECFLKLYTCRQGKDVKVQQM 1931 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,415,385 Number of Sequences: 59808 Number of extensions: 168780 Number of successful extensions: 296 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 252 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 293 length of database: 16,821,457 effective HSP length: 74 effective length of database: 12,395,665 effective search space used: 594991920 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -