BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0842 (808 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_12675| Best HMM Match : Cornichon (HMM E-Value=2.3) 29 3.4 >SB_12675| Best HMM Match : Cornichon (HMM E-Value=2.3) Length = 225 Score = 29.5 bits (63), Expect = 3.4 Identities = 18/81 (22%), Positives = 39/81 (48%), Gaps = 4/81 (4%) Frame = -2 Query: 570 LIIYFIIPDVSLIIIYIFLLRIHLNGNTLLRFNFLYCVKNIN---TIYLTRKISKIITRL 400 L+++ ++ ++ ++ Y+ + R+ Y + I T YLTR +++ +TR Sbjct: 21 LLLFLLLANLVVLTRYVTRYLTRYVTRYVTRYVTRYVTRYITRYVTRYLTRCLTRYVTRY 80 Query: 399 NKKKCMHYI*HSKTKY-ARYL 340 + Y+ H T+Y RY+ Sbjct: 81 MSRYVTRYVTHCVTRYVTRYI 101 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,587,385 Number of Sequences: 59808 Number of extensions: 315183 Number of successful extensions: 597 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 551 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 586 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2239700683 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -