BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0842 (808 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g05080.1 68415.m00530 hypothetical protein low similarity to ... 29 4.8 >At2g05080.1 68415.m00530 hypothetical protein low similarity to SP|Q9UUA2 DNA repair and recombination protein pif1, mitochondrial precursor {Schizosaccharomyces pombe} Length = 1238 Score = 28.7 bits (61), Expect = 4.8 Identities = 15/30 (50%), Positives = 20/30 (66%), Gaps = 3/30 (10%) Frame = -1 Query: 202 FKILHYNIHKRSTPH*KLSFKMP---FLYF 122 ++IL Y IH RST KLSF +P ++YF Sbjct: 573 WRILKYPIHYRSTSVMKLSFHLPGEQYIYF 602 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,277,984 Number of Sequences: 28952 Number of extensions: 223847 Number of successful extensions: 390 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 386 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 390 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1833827200 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -