BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0837 (722 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g42870.1 68418.m05225 lipin family protein contains Pfam prof... 32 0.44 At5g43630.1 68418.m05333 zinc knuckle (CCHC-type) family protein... 29 4.1 At1g44120.1 68414.m05096 C2 domain-containing protein / armadill... 28 5.5 >At5g42870.1 68418.m05225 lipin family protein contains Pfam profile: PF04571 lipin, N-terminal conserved region Length = 930 Score = 31.9 bits (69), Expect = 0.44 Identities = 29/92 (31%), Positives = 37/92 (40%) Frame = -1 Query: 500 SYCSSDVTDNDVVCEGDGSGSLSNDVLKGKSSGSERPQDAAENADFSFSGTD*C*NSGNS 321 S S V D + + D S + +SG Q E FSFS D C GNS Sbjct: 353 SSTGSPVQDENKITIKDMHISAGDFEKSQSASGESILQPEIEEEQFSFSDLDECKPGGNS 412 Query: 320 QD*VESGADVADTTQMQGAEVIALTSVTRPEK 225 G+ +DT ++ G E T T PEK Sbjct: 413 ----SVGSSSSDTVKVDGKESYDETK-TSPEK 439 >At5g43630.1 68418.m05333 zinc knuckle (CCHC-type) family protein contains Pfam domain PF00098: Zinc knuckle Length = 831 Score = 28.7 bits (61), Expect = 4.1 Identities = 14/41 (34%), Positives = 22/41 (53%) Frame = -1 Query: 494 CSSDVTDNDVVCEGDGSGSLSNDVLKGKSSGSERPQDAAEN 372 CS +D+ EG+ L N+ L+ +S+GS+ D A N Sbjct: 142 CSKRSSDSPKAMEGETRDLLVNEQLRMESAGSQEEGDKAHN 182 >At1g44120.1 68414.m05096 C2 domain-containing protein / armadillo/beta-catenin repeat family protein similar to CCLS 65 [Silene latifolia] GI:2570102; contains Pfam profiles PF00514: Armadillo/beta-catenin-like repeat, PF00168: C2 domain Length = 2114 Score = 28.3 bits (60), Expect = 5.5 Identities = 14/45 (31%), Positives = 25/45 (55%) Frame = -1 Query: 509 LANSYCSSDVTDNDVVCEGDGSGSLSNDVLKGKSSGSERPQDAAE 375 L + CSS ++ VV EG+G ++ ++ + KS+ E D+ E Sbjct: 985 LLSIICSSHPSNRLVVMEGNGLEIIAENLQRNKSNTQENSSDSEE 1029 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,877,296 Number of Sequences: 28952 Number of extensions: 263805 Number of successful extensions: 722 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 709 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 722 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1575119672 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -