BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0834 (438 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 08_01_0304 - 2502760-2502774,2502844-2502921,2503035-2503103,250... 37 0.008 07_01_0654 - 4900509-4900518,4900626-4900709,4900844-4901377,490... 32 0.23 03_06_0583 + 34901636-34901721,34901805-34901902,34902029-349021... 28 2.9 01_01_0254 - 2074095-2074100,2074389-2074462,2074572-2074633,207... 27 5.0 01_01_0026 + 201042-201110,201252-201359,202511-202639,203164-20... 27 5.0 >08_01_0304 - 2502760-2502774,2502844-2502921,2503035-2503103, 2503200-2503289,2503400-2503517,2505548-2505678, 2505756-2506025,2507175-2507308,2507635-2508088 Length = 452 Score = 36.7 bits (81), Expect = 0.008 Identities = 29/106 (27%), Positives = 41/106 (38%) Frame = +2 Query: 8 KTSGAFVLKRCTGVRIPQAGTNFSNEICTQQMFTIDFHGEGITSCNKNQTRKIIICVITG 187 K G ++ RCTGV I G N +I T DFHGE K + T Sbjct: 150 KKDGGGLISRCTGVVIGWDGANKRAKILTAASVVCDFHGELHNPALKLSV-SMPNKTTTE 208 Query: 188 GRTTCESARIGTTALLISAVKHYAFRFEGWGSRCNYTETLELVSQG 325 GR + G L+ + Y +GS NY + + + +G Sbjct: 209 GRLLFYNVHYGIA--LLEVMGDYKLEVPSFGSGTNYGQVIFALGRG 252 >07_01_0654 - 4900509-4900518,4900626-4900709,4900844-4901377, 4901462-4901619,4901703-4901832,4901918-4901999, 4902097-4902230,4902314-4902410,4902512-4902788, 4902881-4903024 Length = 549 Score = 31.9 bits (69), Expect = 0.23 Identities = 18/74 (24%), Positives = 34/74 (45%), Gaps = 2/74 (2%) Frame = +2 Query: 62 AGTNFSNEICTQQMFTIDFHGEGITSC-NKNQTRKIIICVITGGRTTCESARIGTTALLI 238 +GT+ + ++ +D G GIT+C +N+ +K ++ G + R+ + Sbjct: 29 SGTSKRRDFTALELILVDEEGVGITACVGENEIQKFSTSIVEGHAYFLRNFRVSRQTKKL 88 Query: 239 SAV-KHYAFRFEGW 277 +AV YA F W Sbjct: 89 NAVPSTYAIFFTPW 102 >03_06_0583 + 34901636-34901721,34901805-34901902,34902029-34902167, 34902262-34902290,34902406-34902502,34902593-34902648, 34902759-34902866,34902988-34903044,34905585-34905679, 34905822-34905998,34906086-34906189,34906595-34906664, 34906774-34906833 Length = 391 Score = 28.3 bits (60), Expect = 2.9 Identities = 11/21 (52%), Positives = 13/21 (61%) Frame = -2 Query: 65 PPAGFEHRCIASTRMHRTSYP 3 PP G +H CI + R H TS P Sbjct: 304 PPTGDQHACIQALRDHWTSIP 324 >01_01_0254 - 2074095-2074100,2074389-2074462,2074572-2074633, 2074790-2075123,2075271-2075487,2075575-2075685, 2076304-2076840 Length = 446 Score = 27.5 bits (58), Expect = 5.0 Identities = 12/44 (27%), Positives = 23/44 (52%) Frame = +3 Query: 252 IMRFGLKGGVAVVTILRL*NLYLKVGGASTL*MSMGSSNHLTSG 383 + + G+ G + V+ R + L +GG ++MG + HL +G Sbjct: 352 LAKLGILGALEVIDAARKARIALMIGGMVETRIAMGFAGHLAAG 395 >01_01_0026 + 201042-201110,201252-201359,202511-202639,203164-203440, 203543-203647,203730-203875,204042-204149,204290-204378, 204552-205098 Length = 525 Score = 27.5 bits (58), Expect = 5.0 Identities = 13/35 (37%), Positives = 20/35 (57%), Gaps = 2/35 (5%) Frame = -1 Query: 99 C*VHISLE--KLVPACGIRTPVHRFNTNAPDVLSF 1 C V SL+ + PACG + P H + + P +L+F Sbjct: 335 CLVKDSLQFGSIAPACGAKDPHHLDSLSEPQILTF 369 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,029,386 Number of Sequences: 37544 Number of extensions: 309124 Number of successful extensions: 651 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 634 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 651 length of database: 14,793,348 effective HSP length: 76 effective length of database: 11,940,004 effective search space used: 823860276 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -