BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0832 (834 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ383732-1|ABD47743.1| 201|Anopheles gambiae IAP-antagonist mic... 26 1.6 AM422833-1|CAM12801.1| 2139|Anopheles gambiae voltage-gated sodi... 25 3.8 AB090824-2|BAC57924.1| 1248|Anopheles gambiae reverse transcript... 25 3.8 AY391746-1|AAR28996.1| 502|Anopheles gambiae putative GPCR prot... 23 8.7 AF043443-1|AAC05668.1| 232|Anopheles gambiae putative pupal-spe... 23 8.7 AF043442-1|AAC05667.1| 231|Anopheles gambiae putative pupal-spe... 23 8.7 AF043441-1|AAC05666.1| 231|Anopheles gambiae putative pupal-spe... 23 8.7 AF043440-1|AAC05665.1| 234|Anopheles gambiae putative pupal-spe... 23 8.7 AF043439-1|AAC05664.1| 239|Anopheles gambiae putative pupal-spe... 23 8.7 AF043438-1|AAC05663.1| 231|Anopheles gambiae putative pupal-spe... 23 8.7 AF043437-1|AAC05662.1| 239|Anopheles gambiae putative pupal-spe... 23 8.7 AF043436-1|AAC05661.1| 263|Anopheles gambiae putative pupal-spe... 23 8.7 AF043435-1|AAC05660.1| 231|Anopheles gambiae pupal-specific cut... 23 8.7 AF043434-1|AAC05659.1| 232|Anopheles gambiae putative pupal-spe... 23 8.7 AF043433-3|AAC05658.1| 231|Anopheles gambiae putative pupal-spe... 23 8.7 AF043433-2|AAC05657.1| 239|Anopheles gambiae putative pupal-spe... 23 8.7 >DQ383732-1|ABD47743.1| 201|Anopheles gambiae IAP-antagonist michelob_x protein. Length = 201 Score = 25.8 bits (54), Expect = 1.6 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = +3 Query: 255 NYCYNYKIVNTSLHLLIVFFREE 323 NY YNY N S H L F+R + Sbjct: 162 NYYYNYYCRNISHHFLRCFYRHK 184 >AM422833-1|CAM12801.1| 2139|Anopheles gambiae voltage-gated sodium channel alpha subunitprotein. Length = 2139 Score = 24.6 bits (51), Expect = 3.8 Identities = 15/70 (21%), Positives = 33/70 (47%), Gaps = 1/70 (1%) Frame = +3 Query: 579 VYILFWL*FIEVLIQ*YAALHYNLTVENKQTVSCKLGCLPTFDKITTRRTRW-SFQQNFV 755 V ++FWL F + +Q +A ++ +NK T+ ++ +P + W + NF Sbjct: 1440 VCLIFWLIFAIMGVQLFAGKYFKCVDKNKTTLPHEI--IPDVNACKAENYSWENSPMNFD 1497 Query: 756 FIRSNFIQLY 785 + ++ L+ Sbjct: 1498 HVGKAYLCLF 1507 >AB090824-2|BAC57924.1| 1248|Anopheles gambiae reverse transcriptase protein. Length = 1248 Score = 24.6 bits (51), Expect = 3.8 Identities = 15/38 (39%), Positives = 18/38 (47%) Frame = +3 Query: 108 DSSVHIVTTPYRRPAPYSGYSRYL*IIARYFNGITCIY 221 D SV IVT+ R P L I+ NGIT +Y Sbjct: 50 DKSVAIVTSGVRYPIQRIRSVTVLGIVVADVNGITIVY 87 >AY391746-1|AAR28996.1| 502|Anopheles gambiae putative GPCR protein. Length = 502 Score = 23.4 bits (48), Expect = 8.7 Identities = 8/20 (40%), Positives = 16/20 (80%), Gaps = 1/20 (5%) Frame = +3 Query: 525 TLCSMLCCFVNI-YIIAWSV 581 T S LCCF+++ +++A++V Sbjct: 196 TFSSSLCCFLSVWFVVAFTV 215 >AF043443-1|AAC05668.1| 232|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 232 Score = 23.4 bits (48), Expect = 8.7 Identities = 8/16 (50%), Positives = 11/16 (68%) Frame = -2 Query: 440 HDRKYGEMQSHHFTRH 393 HD G+++S H TRH Sbjct: 99 HDEHTGDIKSQHETRH 114 >AF043442-1|AAC05667.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2c protein. Length = 231 Score = 23.4 bits (48), Expect = 8.7 Identities = 8/16 (50%), Positives = 11/16 (68%) Frame = -2 Query: 440 HDRKYGEMQSHHFTRH 393 HD G+++S H TRH Sbjct: 91 HDEHTGDIKSQHETRH 106 >AF043441-1|AAC05666.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 231 Score = 23.4 bits (48), Expect = 8.7 Identities = 8/16 (50%), Positives = 11/16 (68%) Frame = -2 Query: 440 HDRKYGEMQSHHFTRH 393 HD G+++S H TRH Sbjct: 91 HDEHTGDIKSQHETRH 106 >AF043440-1|AAC05665.1| 234|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 234 Score = 23.4 bits (48), Expect = 8.7 Identities = 8/16 (50%), Positives = 11/16 (68%) Frame = -2 Query: 440 HDRKYGEMQSHHFTRH 393 HD G+++S H TRH Sbjct: 91 HDEHTGDIKSQHETRH 106 >AF043439-1|AAC05664.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 239 Score = 23.4 bits (48), Expect = 8.7 Identities = 8/16 (50%), Positives = 11/16 (68%) Frame = -2 Query: 440 HDRKYGEMQSHHFTRH 393 HD G+++S H TRH Sbjct: 99 HDEHTGDIKSQHETRH 114 >AF043438-1|AAC05663.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 231 Score = 23.4 bits (48), Expect = 8.7 Identities = 8/16 (50%), Positives = 11/16 (68%) Frame = -2 Query: 440 HDRKYGEMQSHHFTRH 393 HD G+++S H TRH Sbjct: 91 HDEHTGDIKSQHETRH 106 >AF043437-1|AAC05662.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 239 Score = 23.4 bits (48), Expect = 8.7 Identities = 8/16 (50%), Positives = 11/16 (68%) Frame = -2 Query: 440 HDRKYGEMQSHHFTRH 393 HD G+++S H TRH Sbjct: 99 HDEHTGDIKSQHETRH 114 >AF043436-1|AAC05661.1| 263|Anopheles gambiae putative pupal-specific cuticular proteinCP2c protein. Length = 263 Score = 23.4 bits (48), Expect = 8.7 Identities = 8/16 (50%), Positives = 11/16 (68%) Frame = -2 Query: 440 HDRKYGEMQSHHFTRH 393 HD G+++S H TRH Sbjct: 123 HDEHTGDIKSQHETRH 138 >AF043435-1|AAC05660.1| 231|Anopheles gambiae pupal-specific cuticular protein CP2b protein. Length = 231 Score = 23.4 bits (48), Expect = 8.7 Identities = 8/16 (50%), Positives = 11/16 (68%) Frame = -2 Query: 440 HDRKYGEMQSHHFTRH 393 HD G+++S H TRH Sbjct: 91 HDEHTGDIKSQHETRH 106 >AF043434-1|AAC05659.1| 232|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 232 Score = 23.4 bits (48), Expect = 8.7 Identities = 8/16 (50%), Positives = 11/16 (68%) Frame = -2 Query: 440 HDRKYGEMQSHHFTRH 393 HD G+++S H TRH Sbjct: 99 HDEHTGDIKSQHETRH 114 >AF043433-3|AAC05658.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 231 Score = 23.4 bits (48), Expect = 8.7 Identities = 8/16 (50%), Positives = 11/16 (68%) Frame = -2 Query: 440 HDRKYGEMQSHHFTRH 393 HD G+++S H TRH Sbjct: 91 HDEHTGDIKSQHETRH 106 >AF043433-2|AAC05657.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 239 Score = 23.4 bits (48), Expect = 8.7 Identities = 8/16 (50%), Positives = 11/16 (68%) Frame = -2 Query: 440 HDRKYGEMQSHHFTRH 393 HD G+++S H TRH Sbjct: 99 HDEHTGDIKSQHETRH 114 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 835,011 Number of Sequences: 2352 Number of extensions: 15334 Number of successful extensions: 50 Number of sequences better than 10.0: 16 Number of HSP's better than 10.0 without gapping: 49 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 50 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 88065063 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -