BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0832 (834 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY052104-1|AAK93528.1| 712|Drosophila melanogaster SD05186p pro... 33 0.36 AE014297-129|AAF52107.1| 1105|Drosophila melanogaster CG1059-PA ... 33 0.36 >AY052104-1|AAK93528.1| 712|Drosophila melanogaster SD05186p protein. Length = 712 Score = 33.5 bits (73), Expect = 0.36 Identities = 13/34 (38%), Positives = 25/34 (73%) Frame = +1 Query: 13 QMVALLRQIQSNAELFNSCLMTLSNDHKEALQIA 114 +M+ +++Q++SN E+ +C TLS + ++ALQ A Sbjct: 669 RMLTIVKQVESNPEVMAACASTLSPEQQQALQDA 702 >AE014297-129|AAF52107.1| 1105|Drosophila melanogaster CG1059-PA protein. Length = 1105 Score = 33.5 bits (73), Expect = 0.36 Identities = 13/34 (38%), Positives = 25/34 (73%) Frame = +1 Query: 13 QMVALLRQIQSNAELFNSCLMTLSNDHKEALQIA 114 +M+ +++Q++SN E+ +C TLS + ++ALQ A Sbjct: 1062 RMLTIVKQVESNPEVMAACASTLSPEQQQALQDA 1095 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 33,724,722 Number of Sequences: 53049 Number of extensions: 653352 Number of successful extensions: 1481 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1455 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1481 length of database: 24,988,368 effective HSP length: 84 effective length of database: 20,532,252 effective search space used: 3962724636 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -