BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0832 (834 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z99288-5|CAB16548.2| 336|Caenorhabditis elegans Hypothetical pr... 29 3.1 Z47811-4|CAD57701.1| 422|Caenorhabditis elegans Hypothetical pr... 28 9.5 >Z99288-5|CAB16548.2| 336|Caenorhabditis elegans Hypothetical protein ZK262.6 protein. Length = 336 Score = 29.5 bits (63), Expect = 3.1 Identities = 19/65 (29%), Positives = 31/65 (47%) Frame = +1 Query: 418 ISPYLRSCQQFRDCTY*KFEMTKDGLI*QNQTDNALRYVVCYAALLISTLLLGVCTYYFG 597 +S YL C C K G + + T N Y + ++ISTL+ C+Y++G Sbjct: 112 VSYYLGLCLALIRCIIMKMSRNAPGFL--STTRNG--YFLTLFLIIISTLIS--CSYFYG 165 Query: 598 YNLLK 612 Y ++K Sbjct: 166 YKIIK 170 >Z47811-4|CAD57701.1| 422|Caenorhabditis elegans Hypothetical protein K02C4.5 protein. Length = 422 Score = 27.9 bits (59), Expect = 9.5 Identities = 13/51 (25%), Positives = 27/51 (52%) Frame = -3 Query: 556 LTKQHNILHNVVRYQFDFVKSGHLSSFRTSNMYNHGTVDMTVNMEKCNRTI 404 + K H+ N ++ D K+ HL+ ++ N+Y+ G VD+ M + ++ Sbjct: 49 IAKVHSRTANNLKKYMDPKKNEHLNLWKMCNVYSCGAVDLDKAMRETRSSL 99 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,942,194 Number of Sequences: 27780 Number of extensions: 361967 Number of successful extensions: 912 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 882 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 912 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 2072006206 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -