BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0831 (751 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g08160.1 68417.m01347 glycosyl hydrolase family 10 protein / ... 28 7.6 >At4g08160.1 68417.m01347 glycosyl hydrolase family 10 protein / carbohydrate-binding domain-containing protein ; contains Pfam profiles PF00331: Glycosyl hydrolase family 10, PF02018: Carbohydrate binding domain Length = 752 Score = 27.9 bits (59), Expect = 7.6 Identities = 13/40 (32%), Positives = 25/40 (62%), Gaps = 1/40 (2%) Frame = -1 Query: 142 INVCDILDRRQKHL-NLSKLYKGLYKYFIISHHMHLSSYY 26 +N D+++ QK L +L YKG +K++ +++ M S+Y Sbjct: 494 LNKTDLMNAVQKRLTDLLTRYKGKFKHYDVNNEMLHGSFY 533 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,325,693 Number of Sequences: 28952 Number of extensions: 276325 Number of successful extensions: 517 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 511 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 517 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1663169840 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -