BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0828 (820 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC16C9.02c |||S-methyl-5-thioadenosine phosphorylase|Schizosac... 29 1.0 SPCC663.14c |||TRP-like ion channel|Schizosaccharomyces pombe|ch... 27 2.4 SPBC13G1.14c |||RNA-binding protein|Schizosaccharomyces pombe|ch... 27 4.2 SPAC26A3.01 |sxa1|SPAC2E1P5.06|aspartic protease Sxa1 |Schizosac... 27 4.2 SPAC16E8.11c |tfb1||transcription factor TFIIH complex subunit T... 25 9.8 SPAC27E2.02 |||IMPACT homolog|Schizosaccharomyces pombe|chr 1|||... 25 9.8 >SPAC16C9.02c |||S-methyl-5-thioadenosine phosphorylase|Schizosaccharomyces pombe|chr 1|||Manual Length = 307 Score = 28.7 bits (61), Expect = 1.0 Identities = 16/45 (35%), Positives = 23/45 (51%), Gaps = 1/45 (2%) Frame = +3 Query: 642 DNTDLGAP-AFFQNALVGIVSFGKSNANDIYPVVLTSISSFMNGS 773 D T P FF++ V VSFG D+Y ++ + S+ NGS Sbjct: 114 DRTLCARPNTFFESGCVAHVSFGDPFDQDLYEILSSCGSNLKNGS 158 >SPCC663.14c |||TRP-like ion channel|Schizosaccharomyces pombe|chr 3|||Manual Length = 687 Score = 27.5 bits (58), Expect = 2.4 Identities = 12/29 (41%), Positives = 18/29 (62%) Frame = -2 Query: 87 RSLAVQLQTAASTATAKVRTETIVPIESN 1 R L + + A +A+ K+ TE I+P ESN Sbjct: 605 RQLHIDFENPAVSASEKLSTEEIIPQESN 633 >SPBC13G1.14c |||RNA-binding protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 243 Score = 26.6 bits (56), Expect = 4.2 Identities = 12/36 (33%), Positives = 17/36 (47%) Frame = -2 Query: 684 AHFGRRQGHPSQYCRSRGHQPGPNRRRICYQSRRDH 577 +H+ + H S+Y R+R PG N QS H Sbjct: 202 SHYNDKSFHRSRYSRARSRSPGSNISEYSDQSPPYH 237 >SPAC26A3.01 |sxa1|SPAC2E1P5.06|aspartic protease Sxa1 |Schizosaccharomyces pombe|chr 1|||Manual Length = 533 Score = 26.6 bits (56), Expect = 4.2 Identities = 11/35 (31%), Positives = 20/35 (57%) Frame = -2 Query: 513 CRRYTAALNGSSPSEQINKNTLGYYDTLLDNSTLL 409 C YT S+ + + N +T+G+ + DN+T+L Sbjct: 136 CTNYTCFDYSSTTARRTNSSTIGFLASYGDNTTVL 170 >SPAC16E8.11c |tfb1||transcription factor TFIIH complex subunit Tfb1|Schizosaccharomyces pombe|chr 1|||Manual Length = 477 Score = 25.4 bits (53), Expect = 9.8 Identities = 13/42 (30%), Positives = 22/42 (52%), Gaps = 1/42 (2%) Frame = +2 Query: 449 RVFLLICSDGELPFKAAVYLRQPPQARTHCDQ-QRKLQGTVQ 571 RVF+++ +GE P + P AR +CD +L+ +Q Sbjct: 3 RVFIVV-KEGEDPTSLVFHFTGTPNARENCDMITNELRNAIQ 43 >SPAC27E2.02 |||IMPACT homolog|Schizosaccharomyces pombe|chr 1|||Manual Length = 280 Score = 25.4 bits (53), Expect = 9.8 Identities = 17/53 (32%), Positives = 24/53 (45%) Frame = +2 Query: 233 EFYDPAYLALSLDLPVAVSPVKYLMFTLLLTIPNSLRRITTRM*ASYE*HMPS 391 EF D LAL P + P+ FT L+IP+S R+ + Y P+ Sbjct: 6 EFQDEL-LALESIYPSCLLPISEQSFTYTLSIPDSSVRLNIQFPLDYPNSAPT 57 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,569,520 Number of Sequences: 5004 Number of extensions: 80249 Number of successful extensions: 252 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 242 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 252 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 400438000 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -