BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0828 (820 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 08_02_0200 - 14179389-14180488,14180575-14180736,14180983-141813... 30 2.5 01_02_0116 - 11252220-11253313,11253398-11253559,11253977-112543... 30 2.5 11_04_0454 - 17895935-17896093,17896878-17896911,17897114-178972... 29 3.4 05_03_0608 + 16153992-16154960,16158959-16159168,16159252-161595... 28 7.8 02_05_1091 + 34044999-34045082,34046848-34047048,34047312-340475... 28 7.8 01_06_0125 + 26711157-26713297,26715026-26715206 28 7.8 >08_02_0200 - 14179389-14180488,14180575-14180736,14180983-14181383, 14182078-14182272,14182980-14183094,14183180-14183428, 14184032-14184093,14184335-14184435,14184701-14184815, 14185211-14185302,14187619-14187777 Length = 916 Score = 29.9 bits (64), Expect = 2.5 Identities = 11/23 (47%), Positives = 14/23 (60%) Frame = -3 Query: 212 LKGSGSW*EQYQRTVGTIDSRWV 144 +KG W +YQR GTID W+ Sbjct: 701 VKGLDEWPNEYQRQYGTIDLYWI 723 >01_02_0116 - 11252220-11253313,11253398-11253559,11253977-11254306, 11254328-11254377,11255195-11255389,11255532-11255625, 11255713-11255961,11256831-11256892,11257434-11257534, 11257766-11257880,11258384-11258475,11259197-11259333, 11259721-11259760 Length = 906 Score = 29.9 bits (64), Expect = 2.5 Identities = 11/23 (47%), Positives = 14/23 (60%) Frame = -3 Query: 212 LKGSGSW*EQYQRTVGTIDSRWV 144 +KG W +YQR GTID W+ Sbjct: 693 VKGLDEWPNEYQRQYGTIDLYWI 715 >11_04_0454 - 17895935-17896093,17896878-17896911,17897114-17897252, 17897487-17897561,17897666-17897945 Length = 228 Score = 29.5 bits (63), Expect = 3.4 Identities = 12/22 (54%), Positives = 15/22 (68%) Frame = -2 Query: 672 RRQGHPSQYCRSRGHQPGPNRR 607 RR+ H ++ R RG QP PNRR Sbjct: 27 RRRRHHQRHRRRRGGQPAPNRR 48 >05_03_0608 + 16153992-16154960,16158959-16159168,16159252-16159512, 16160153-16160197,16160324-16160410,16160679-16160774 Length = 555 Score = 28.3 bits (60), Expect = 7.8 Identities = 15/37 (40%), Positives = 19/37 (51%) Frame = -2 Query: 540 SQ*VRACGGCRRYTAALNGSSPSEQINKNTLGYYDTL 430 SQ +RA R TAA+ S +N T+ Y DTL Sbjct: 360 SQRIRAADSKRIATAAVKASRACRDLNTQTVKYLDTL 396 >02_05_1091 + 34044999-34045082,34046848-34047048,34047312-34047523, 34047846-34048413 Length = 354 Score = 28.3 bits (60), Expect = 7.8 Identities = 15/51 (29%), Positives = 22/51 (43%) Frame = -2 Query: 402 WAEVDGMCYSYDAHILVVILLREFGMVNSKVNIRYFTGLTATGRSSDNARY 250 W+++ G Y DAH+ + L FG + I F G+ D A Y Sbjct: 58 WSDIGGRDYMEDAHVCISDLANNFGHNSVDDEIISFYGVFDGHGGKDAAHY 108 >01_06_0125 + 26711157-26713297,26715026-26715206 Length = 773 Score = 28.3 bits (60), Expect = 7.8 Identities = 15/51 (29%), Positives = 24/51 (47%) Frame = -3 Query: 755 TDAGEYYGVDVIGIALSKRYDAY*RILEEGRGTQVSIVVVAATSPDQTGAE 603 ++ GE GVD I ++ S D + +E GRG + ++ D G E Sbjct: 109 SEEGEVRGVDFIDLSSSSSDDEEEKEVEAGRGAGSRVPIIKEAPDDAEGDE 159 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 24,215,315 Number of Sequences: 37544 Number of extensions: 576084 Number of successful extensions: 1549 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 1506 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1548 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2244686244 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -