Bombyx BLAST Result against rice

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= mg--0826
         (836 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

05_02_0120 - 6797954-6798970,6799466-6799951                           32   0.65 

>05_02_0120 - 6797954-6798970,6799466-6799951
          Length = 500

 Score = 31.9 bits (69), Expect = 0.65
 Identities = 24/70 (34%), Positives = 33/70 (47%), Gaps = 7/70 (10%)
 Frame = -1

Query: 203 ETLNRQIKQITLSAFPP-----KSPARAFI--GRVGRRAYGPPDGE*LPSPMDFRNARGR 45
           +TL R +K+ TL   PP     +   R+F+  G  G R Y  P+G  + SP+   NA  R
Sbjct: 351 DTLQRCVKE-TLRLHPPALMLLRHARRSFVVRGGSGEREYEVPEGHTVASPLLLHNALPR 409

Query: 44  *YRSHKNMAP 15
            YR      P
Sbjct: 410 VYRDPGEFDP 419


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 19,942,051
Number of Sequences: 37544
Number of extensions: 383508
Number of successful extensions: 692
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 684
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 692
length of database: 14,793,348
effective HSP length: 81
effective length of database: 11,752,284
effective search space used: 2315199948
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)