BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0819 (817 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein. 26 1.6 AY578799-1|AAT07304.1| 679|Anopheles gambiae brinker protein. 24 6.4 >AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein. Length = 1459 Score = 25.8 bits (54), Expect = 1.6 Identities = 11/22 (50%), Positives = 15/22 (68%) Frame = +1 Query: 229 KSNCILTKHNEVHIYKKEGNDW 294 KSNC L K + ++IY GND+ Sbjct: 1211 KSNC-LNKRSAINIYATAGNDY 1231 >AY578799-1|AAT07304.1| 679|Anopheles gambiae brinker protein. Length = 679 Score = 23.8 bits (49), Expect = 6.4 Identities = 17/57 (29%), Positives = 23/57 (40%), Gaps = 2/57 (3%) Frame = -2 Query: 471 SRCSVDTQKNKSSCPFPII-SLSP-DVSITVNRTRNNTVGVGSPINPHHSKVVFHKV 307 S CS + + +SC SL P +V+ VG P NP V+F V Sbjct: 236 SSCSPLSTASSASCSSSAAGSLCPTSPPASVSNGEQPASSVGDPANPQQPSVIFSPV 292 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 881,651 Number of Sequences: 2352 Number of extensions: 18447 Number of successful extensions: 23 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 23 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 23 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 86487024 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -