BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0818 (363 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g44080.1 68416.m04722 F-box family protein contains F-box dom... 26 6.5 >At3g44080.1 68416.m04722 F-box family protein contains F-box domain Pfam:PF00646 Length = 387 Score = 26.2 bits (55), Expect = 6.5 Identities = 13/32 (40%), Positives = 18/32 (56%) Frame = +2 Query: 44 KQRYNNSVYKESFKTLQCLVFLLMIYDYYFYH 139 KQ + S+ + +KTL LV L I DY +H Sbjct: 27 KQAVSTSLLSKRWKTLYSLVHNLDIDDYILFH 58 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 5,456,158 Number of Sequences: 28952 Number of extensions: 75484 Number of successful extensions: 127 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 127 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 127 length of database: 12,070,560 effective HSP length: 73 effective length of database: 9,957,064 effective search space used: 467982008 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -