BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0815 (545 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AC025727-4|AAG23388.3| 463|Caenorhabditis elegans Hypothetical ... 29 2.9 U23511-1|AAC46791.1| 859|Caenorhabditis elegans Hypothetical pr... 28 3.8 AF025457-12|AAY55849.1| 244|Caenorhabditis elegans Hypothetical... 27 8.8 >AC025727-4|AAG23388.3| 463|Caenorhabditis elegans Hypothetical protein Y73E7A.2 protein. Length = 463 Score = 28.7 bits (61), Expect = 2.9 Identities = 14/30 (46%), Positives = 19/30 (63%) Frame = +1 Query: 112 ILNTPKNMNKTKYTRYWKISISNLIQNQMA 201 ILNTPK+MN T ++ + K SI I +A Sbjct: 306 ILNTPKSMNNTDFSVFEKGSILGQINKVLA 335 >U23511-1|AAC46791.1| 859|Caenorhabditis elegans Hypothetical protein C32D5.3 protein. Length = 859 Score = 28.3 bits (60), Expect = 3.8 Identities = 11/27 (40%), Positives = 17/27 (62%) Frame = -2 Query: 523 KKHVHHQLIKKTTNLCPVIIQNPSLCK 443 K++ H ++ K NL +I NPSLC+ Sbjct: 583 KRNCIHNMVAKYLNLSAQLIANPSLCQ 609 >AF025457-12|AAY55849.1| 244|Caenorhabditis elegans Hypothetical protein C08E3.14 protein. Length = 244 Score = 27.1 bits (57), Expect = 8.8 Identities = 11/29 (37%), Positives = 19/29 (65%) Frame = +1 Query: 151 TRYWKISISNLIQNQMAY*IQIYTFEILK 237 T+ WKI+ SNL N+++ + +TF +K Sbjct: 120 TQKWKITTSNLHVNELSLAVSSFTFGCVK 148 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,008,409 Number of Sequences: 27780 Number of extensions: 282608 Number of successful extensions: 617 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 594 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 617 length of database: 12,740,198 effective HSP length: 77 effective length of database: 10,601,138 effective search space used: 1102518352 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -