BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0814 (470 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439398-8|CAD28131.1| 1283|Anopheles gambiae putative different... 26 0.76 CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskel... 25 1.0 DQ370045-1|ABD18606.1| 285|Anopheles gambiae putative TIL domai... 25 1.3 AJ439353-11|CAD27933.1| 615|Anopheles gambiae 30E5.11 protein. 23 4.1 AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein. 23 5.4 AF395080-1|AAK97462.1| 537|Anopheles gambiae zinc finger transc... 22 9.4 >AJ439398-8|CAD28131.1| 1283|Anopheles gambiae putative differentiation regulator protein. Length = 1283 Score = 25.8 bits (54), Expect = 0.76 Identities = 13/29 (44%), Positives = 15/29 (51%) Frame = +3 Query: 309 EVEQRVHNRQGHEGVHLAAARQGHPPHHR 395 E +QR + Q H G AAA PP HR Sbjct: 896 EQQQRSSSSQQHRGPGAAAATGPPPPTHR 924 >CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskeletal structural protein protein. Length = 1645 Score = 25.4 bits (53), Expect = 1.0 Identities = 10/28 (35%), Positives = 15/28 (53%) Frame = +3 Query: 285 LHGTHLRHEVEQRVHNRQGHEGVHLAAA 368 L+ +HL H + H+ G EGV + A Sbjct: 1309 LNSSHLHHHLHHGHHHHHGGEGVPMGPA 1336 >DQ370045-1|ABD18606.1| 285|Anopheles gambiae putative TIL domain protein protein. Length = 285 Score = 25.0 bits (52), Expect = 1.3 Identities = 11/42 (26%), Positives = 16/42 (38%) Frame = -2 Query: 415 CACPAPRRW*GGCPCRAAARCTPSCPCRL*TRCSTSWRRCVP 290 C P P++ + C P C C+ T + CVP Sbjct: 34 CCAPCPQKACISEAVKCQTSCLPGCVCKKGFVRETQFGNCVP 75 >AJ439353-11|CAD27933.1| 615|Anopheles gambiae 30E5.11 protein. Length = 615 Score = 23.4 bits (48), Expect = 4.1 Identities = 11/30 (36%), Positives = 17/30 (56%) Frame = -2 Query: 94 ADGAAIMRYQVRNILRSGRHTLDFTQLVLS 5 AD AA +RY + + RH L + Q ++S Sbjct: 483 ADTAAELRYAKEHADKENRHFLQYAQDLIS 512 >AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein. Length = 1459 Score = 23.0 bits (47), Expect = 5.4 Identities = 9/22 (40%), Positives = 13/22 (59%) Frame = +3 Query: 378 HPPHHRRGAGQAHRSQGRRAVG 443 HP HH G+G++ + G VG Sbjct: 1402 HPHHHHNGSGRS-KPPGPEGVG 1422 >AF395080-1|AAK97462.1| 537|Anopheles gambiae zinc finger transcription factor pannier protein. Length = 537 Score = 22.2 bits (45), Expect = 9.4 Identities = 12/35 (34%), Positives = 14/35 (40%) Frame = -2 Query: 370 RAAARCTPSCPCRL*TRCSTSWRRCVPWSP*CAQC 266 + A R C TR +T WRR P C C Sbjct: 167 QTATRRLGLCCTNCGTRTTTLWRRNNDGEPVCNAC 201 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 547,570 Number of Sequences: 2352 Number of extensions: 11810 Number of successful extensions: 26 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 26 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 26 length of database: 563,979 effective HSP length: 59 effective length of database: 425,211 effective search space used: 41245467 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -