BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0813 (431 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g38440.1 68417.m05432 expressed protein 30 0.78 At1g78370.1 68414.m09133 glutathione S-transferase, putative sim... 28 3.1 >At4g38440.1 68417.m05432 expressed protein Length = 1465 Score = 29.9 bits (64), Expect = 0.78 Identities = 18/54 (33%), Positives = 31/54 (57%) Frame = -3 Query: 387 SYEKRYHKTLIG*FSNLGPKASHLILFS*P*RYRNYKSQ*IRCHATGTWSYNYI 226 S+EK K LI F+++ +A +L+L + N SQ I + +GTW ++Y+ Sbjct: 708 SFEKLREKNLISEFTSVSNEA-YLVLEAFAETLPNMYSQNIPRNESGTWDWSYV 760 >At1g78370.1 68414.m09133 glutathione S-transferase, putative similar to 2,4-D inducible glutathione S-transferase GI:2920666 from [Glycine max] Length = 217 Score = 27.9 bits (59), Expect = 3.1 Identities = 15/40 (37%), Positives = 22/40 (55%) Frame = -1 Query: 215 LLN*ELYIKNYPKSHSYHWSEIQILTCLLFFQCVLKFGNF 96 +L EL K Y S+ + +I ++T +FQ KFGNF Sbjct: 134 ILESELGDKPYFGGDSFGYVDISLITFSSWFQAYEKFGNF 173 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,353,170 Number of Sequences: 28952 Number of extensions: 152889 Number of successful extensions: 266 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 264 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 266 length of database: 12,070,560 effective HSP length: 74 effective length of database: 9,928,112 effective search space used: 685039728 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -