BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0812 (733 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 05_05_0039 - 21782093-21782320,21782383-21782754,21783031-217834... 30 1.6 >05_05_0039 - 21782093-21782320,21782383-21782754,21783031-21783496, 21784896-21784993,21785179-21785362,21785462-21785574, 21785942-21786127,21786191-21786364 Length = 606 Score = 30.3 bits (65), Expect = 1.6 Identities = 17/55 (30%), Positives = 29/55 (52%), Gaps = 1/55 (1%) Frame = +2 Query: 89 IHFSILYYILY-FGATKKYLFLSHYEYKSERFLYTYHTEYIFVFTNYLSSVPSVY 250 ++F+ ILY FG + + H +K ++F Y Y ++VFT L S ++Y Sbjct: 233 LYFTGATNILYTFGGHAVTVEIMHAMWKPQKFKYIYLVATLYVFTLTLPSASAMY 287 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,240,903 Number of Sequences: 37544 Number of extensions: 233254 Number of successful extensions: 373 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 370 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 373 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1921741964 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -