BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0812 (733 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF281078-1|AAF82131.1| 2051|Anopheles gambiae vitellogenin 1 pro... 31 0.028 AJ439060-14|CAD27765.1| 471|Anopheles gambiae putative acetyltr... 26 1.0 AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. 23 9.7 AF008575-1|AAB87764.1| 525|Anopheles gambiae chitinase protein. 23 9.7 >AF281078-1|AAF82131.1| 2051|Anopheles gambiae vitellogenin 1 protein. Length = 2051 Score = 31.5 bits (68), Expect = 0.028 Identities = 18/53 (33%), Positives = 27/53 (50%), Gaps = 7/53 (13%) Frame = +2 Query: 95 FSILYYILYFGAT------KKY-LFLSHYEYKSERFLYTYHTEYIFVFTNYLS 232 FS YY++ T K+Y + H EYKS + Y Y+ +Y +F +Y S Sbjct: 934 FSTFYYLISSMETFFDLLDKQYDSYNKHQEYKSSDYYYKYYKQYPHLFKDYFS 986 >AJ439060-14|CAD27765.1| 471|Anopheles gambiae putative acetyltransferase protein. Length = 471 Score = 26.2 bits (55), Expect = 1.0 Identities = 16/55 (29%), Positives = 30/55 (54%), Gaps = 2/55 (3%) Frame = +2 Query: 62 IYSVCSISKIHFSILYYILYFGATKKYLFLSHYE--YKSERFLYTYHTEYIFVFT 220 + ++CSISKI +L AT++YL+ + E + + R + + ++ F FT Sbjct: 98 VIALCSISKIPSCARRCLLEVIATQEYLYYLNIEHIFVALRDQHVFRAKFRFSFT 152 >AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. Length = 3398 Score = 23.0 bits (47), Expect = 9.7 Identities = 10/34 (29%), Positives = 17/34 (50%) Frame = +2 Query: 107 YYILYFGATKKYLFLSHYEYKSERFLYTYHTEYI 208 Y +Y G K LF +H++ + +TEY+ Sbjct: 2177 YTPIYEGLISKTLFTAHWQKATSPLRNGIYTEYL 2210 >AF008575-1|AAB87764.1| 525|Anopheles gambiae chitinase protein. Length = 525 Score = 23.0 bits (47), Expect = 9.7 Identities = 10/20 (50%), Positives = 13/20 (65%) Frame = -1 Query: 298 TACTSDRLNLFNVSI*IHRW 239 +A T+DRL NV+ IH W Sbjct: 243 SADTTDRLGQINVNASIHFW 262 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 656,410 Number of Sequences: 2352 Number of extensions: 11577 Number of successful extensions: 17 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 16 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 17 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 74844540 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -