BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0811 (705 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_05_1347 + 35837967-35838060,35838524-35838783 31 1.2 04_01_0420 - 5561632-5563908 29 2.7 11_04_0426 - 17573681-17574010,17574163-17574282,17574382-175747... 29 4.8 02_05_0226 + 26971851-26972034,26972734-26972834,26972876-269729... 29 4.8 03_01_0046 - 384444-384460,384649-384770,385144-385301,385379-38... 28 6.3 >02_05_1347 + 35837967-35838060,35838524-35838783 Length = 117 Score = 30.7 bits (66), Expect = 1.2 Identities = 16/34 (47%), Positives = 19/34 (55%) Frame = +2 Query: 557 ATSPTPSLTSSHRPCQPLLPITGPQSTGFGIYLL 658 A SPT L+SSH+PC+ L T T G Y L Sbjct: 2 AASPTRLLSSSHQPCKESLHCTATGRTWAGEYEL 35 >04_01_0420 - 5561632-5563908 Length = 758 Score = 29.5 bits (63), Expect = 2.7 Identities = 14/36 (38%), Positives = 19/36 (52%) Frame = +3 Query: 102 LVTNQVASAIENIRKQIREAGFDPLDVDRREIVIPP 209 LVT A+ + R+ G PL+V R E+V PP Sbjct: 661 LVTLTAAAPVATARRTATNIGKQPLEVYRAEVVAPP 696 >11_04_0426 - 17573681-17574010,17574163-17574282,17574382-17574754, 17575051-17575087,17575821-17575872 Length = 303 Score = 28.7 bits (61), Expect = 4.8 Identities = 23/65 (35%), Positives = 31/65 (47%) Frame = +3 Query: 48 ASTQTFDEQTEINARQERLVTNQVASAIENIRKQIREAGFDPLDVDRREIVIPPEEDFHA 227 A+T T D+ +E +V SA ++ K RE P+DV+ PPEED A Sbjct: 229 AATATGDDDHSAAGVKEHVVNIAKLSAAVDVVKT-REV--HPVDVESPPAEAPPEEDDKA 285 Query: 228 LAAFA 242 AA A Sbjct: 286 AAATA 290 >02_05_0226 + 26971851-26972034,26972734-26972834,26972876-26972978, 26973335-26973477,26973525-26973605,26973929-26974015, 26974097-26974239,26974746-26974896,26974973-26975095, 26975362-26975445,26975531-26975718,26976726-26976900, 26977008-26977129,26977231-26977310,26977532-26977590, 26977921-26978075,26978680-26978858,26980050-26980162, 26980243-26980413,26980552-26980680,26980756-26980856, 26980942-26981059,26981739-26981818,26983230-26983302, 26983865-26983950,26984025-26984076,26984221-26984352, 26984560-26984628,26984912-26985004,26985806-26985901, 26986710-26986808,26986894-26986986,26987459-26987608, 26988391-26988549 Length = 1323 Score = 28.7 bits (61), Expect = 4.8 Identities = 16/46 (34%), Positives = 25/46 (54%) Frame = +1 Query: 88 HVKSAWSLTRLLPPSKISESK*EKPDSIHWTLIEEKLSSLQRKTSM 225 H +++S++ L+PPSK+ K EK S I E+L R T + Sbjct: 1056 HAPASYSISYLIPPSKVDNDK-EKGVSSGRKSISERLDDEVRDTKI 1100 >03_01_0046 - 384444-384460,384649-384770,385144-385301,385379-385479, 385748-385823,385983-386093,386165-386356,386729-387024, 388299-388497 Length = 423 Score = 28.3 bits (60), Expect = 6.3 Identities = 18/62 (29%), Positives = 31/62 (50%) Frame = -2 Query: 221 EVFLWRDDNFSSINVQWIESGFSYLLSDIFDGGSNLVSDQALLTCVYLRLFIKSLCTGTS 42 ++F+W NF +N Q ++S Y+ FDG V ++ + C + I TG+S Sbjct: 76 QLFIWFQFNFI-VNSQALKS---YIWLQCFDGSIQQVEEEVAMFCPMICREIVKNGTGSS 131 Query: 41 QN 36 +N Sbjct: 132 KN 133 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,535,585 Number of Sequences: 37544 Number of extensions: 350984 Number of successful extensions: 904 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 878 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 904 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1815633512 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -