BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0807 (799 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF119382-1|AAD27585.1| 394|Anopheles gambiae caudal protein hom... 25 2.7 AJ441131-1|CAD29630.1| 567|Anopheles gambiae putative chitin bi... 25 3.6 AY301275-1|AAQ67361.1| 611|Anopheles gambiae G-protein coupled ... 24 6.3 AJ439353-2|CAD27924.1| 612|Anopheles gambiae putative G-protein... 24 6.3 X95912-1|CAA65156.1| 696|Anopheles gambiae immune factor protein. 23 8.3 >AF119382-1|AAD27585.1| 394|Anopheles gambiae caudal protein homolog protein. Length = 394 Score = 25.0 bits (52), Expect = 2.7 Identities = 10/27 (37%), Positives = 14/27 (51%) Frame = -1 Query: 433 HDHGGHQGHVTNVHWARGHNGGVSHDH 353 H H H G+ + G +GG +HDH Sbjct: 124 HHHHHHHGNNGGGNGGGGGSGGNAHDH 150 >AJ441131-1|CAD29630.1| 567|Anopheles gambiae putative chitin binding protein protein. Length = 567 Score = 24.6 bits (51), Expect = 3.6 Identities = 10/22 (45%), Positives = 15/22 (68%) Frame = +1 Query: 70 NVDTTRAQMSVLP*SKLPSSHP 135 N+ T + VLP SK+P+S+P Sbjct: 31 NIRTGANNIGVLPASKMPTSYP 52 >AY301275-1|AAQ67361.1| 611|Anopheles gambiae G-protein coupled receptor protein. Length = 611 Score = 23.8 bits (49), Expect = 6.3 Identities = 10/40 (25%), Positives = 21/40 (52%) Frame = -1 Query: 787 IYLTHLMIITIINDTCKSCKLYFHVKSTCRRCHLVIFLYF 668 +YL+ +++ + D + K +T RRCH +F+ + Sbjct: 267 LYLSTYVLVLVGVDRWVAVKYPMKSLNTARRCHRFLFVAY 306 >AJ439353-2|CAD27924.1| 612|Anopheles gambiae putative G-protein coupled receptor protein. Length = 612 Score = 23.8 bits (49), Expect = 6.3 Identities = 10/40 (25%), Positives = 21/40 (52%) Frame = -1 Query: 787 IYLTHLMIITIINDTCKSCKLYFHVKSTCRRCHLVIFLYF 668 +YL+ +++ + D + K +T RRCH +F+ + Sbjct: 268 LYLSTYVLVLVGVDRWVAVKYPMKSLNTARRCHRFLFVAY 307 >X95912-1|CAA65156.1| 696|Anopheles gambiae immune factor protein. Length = 696 Score = 23.4 bits (48), Expect = 8.3 Identities = 14/34 (41%), Positives = 17/34 (50%), Gaps = 3/34 (8%) Frame = +3 Query: 84 ESPDVGPALVEAPIVPSPVHVG---PLVPGQLTP 176 +S GP A + PSP G PL PG +TP Sbjct: 439 QSTSPGPDRSPATLTPSPGIGGPISPLDPGNVTP 472 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 583,969 Number of Sequences: 2352 Number of extensions: 9582 Number of successful extensions: 27 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 25 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 27 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 83992206 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -