BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0805 (397 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g43630.1 68418.m05333 zinc knuckle (CCHC-type) family protein... 30 0.49 At3g13410.1 68416.m01686 expressed protein 29 1.1 At1g55830.1 68414.m06402 expressed protein similar to M-type 9 p... 29 1.1 At4g01960.1 68417.m00261 expressed protein 28 2.0 At2g43810.1 68415.m05446 small nuclear ribonucleoprotein F, puta... 28 2.6 At1g44120.1 68414.m05096 C2 domain-containing protein / armadill... 28 2.6 At5g15130.1 68418.m01773 WRKY family transcription factor contai... 27 3.4 At1g36730.1 68414.m04569 eukaryotic translation initiation facto... 27 3.4 At4g33300.1 68417.m04737 disease resistance protein (CC-NBS-LRR ... 27 4.5 At4g09790.1 68417.m01608 F-box family protein hypothetical prote... 27 6.0 At3g20660.1 68416.m02615 organic cation transporter family prote... 27 6.0 At1g75820.1 68414.m08807 CLAVATA1 receptor kinase (CLV1) identic... 26 7.9 At1g48120.1 68414.m05370 calcineurin-like phosphoesterase family... 26 7.9 At1g41900.1 68414.m04840 myosin heavy chain-related similar to M... 26 7.9 >At5g43630.1 68418.m05333 zinc knuckle (CCHC-type) family protein contains Pfam domain PF00098: Zinc knuckle Length = 831 Score = 30.3 bits (65), Expect = 0.49 Identities = 19/57 (33%), Positives = 28/57 (49%), Gaps = 2/57 (3%) Frame = -1 Query: 211 EIDLEVRFDIANSY--CSSDVTDNDVVCEGDGSGSLSNDVLKGKSSGSERPQDAAEN 47 E +E DI N CS +D+ EG+ L N+ L+ +S+GS+ D A N Sbjct: 126 EDKVETNDDIKNEEAGCSKRSSDSPKAMEGETRDLLVNEQLRMESAGSQEEGDKAHN 182 >At3g13410.1 68416.m01686 expressed protein Length = 321 Score = 29.1 bits (62), Expect = 1.1 Identities = 14/44 (31%), Positives = 22/44 (50%) Frame = -1 Query: 235 GWSNFASEEIDLEVRFDIANSYCSSDVTDNDVVCEGDGSGSLSN 104 GWSNF E LE D+A + ++ +DV + + +L N Sbjct: 70 GWSNFLCSEKKLEQPVDVALVFIGRELLSSDVSSKRNSDPALVN 113 >At1g55830.1 68414.m06402 expressed protein similar to M-type 9 protein (GI:507127) [Streptococcus pyogenes] Length = 509 Score = 29.1 bits (62), Expect = 1.1 Identities = 21/79 (26%), Positives = 35/79 (44%), Gaps = 1/79 (1%) Frame = -2 Query: 249 RKLLTAGP-TSRPKRLIWRLDLTSPIVIAAPMSLTMMLSARETEAVASATTFSRASPPEA 73 RK LTAG SRPK +R D++ +++ T + ++ EAV T + + Sbjct: 130 RKTLTAGDIASRPKMETFR-DISDDMMVNEDKDETFDMHIQKVEAVLKDLTMTSEKSHSS 188 Query: 72 KDLRTRLKMRISPSAEPTD 16 L + S++ TD Sbjct: 189 DSLAKNTSANVDFSSQKTD 207 >At4g01960.1 68417.m00261 expressed protein Length = 236 Score = 28.3 bits (60), Expect = 2.0 Identities = 20/56 (35%), Positives = 30/56 (53%), Gaps = 2/56 (3%) Frame = -1 Query: 220 ASEEIDLEVRFDIANSYCSSDVTDNDVVCEGDGSGSLSNDVLKGKSS--GSERPQD 59 + EE DL+V + + ++T N V EGD S ++ N V G+ S GSE+ D Sbjct: 6 SGEEEDLDVDIEDGRFNETQEITTNLVSAEGD-SENVLNHVWSGRLSFDGSEKSAD 60 >At2g43810.1 68415.m05446 small nuclear ribonucleoprotein F, putative / U6 snRNA-associated Sm-like protein, putative / Sm protein F, putative similar to SWISS-PROT:Q9Y4Y8 U6 snRNA-associated Sm-like protein LSm6 [Mus musculus] Length = 91 Score = 27.9 bits (59), Expect = 2.6 Identities = 14/46 (30%), Positives = 25/46 (54%) Frame = -1 Query: 241 VDGWSNFASEEIDLEVRFDIANSYCSSDVTDNDVVCEGDGSGSLSN 104 +DG+ N A E+ + V + N+Y + V N+V+ G+LS+ Sbjct: 44 LDGYMNIAMEQTEEYVNGQLKNTYGDAFVRGNNVLYISTTKGTLSD 89 >At1g44120.1 68414.m05096 C2 domain-containing protein / armadillo/beta-catenin repeat family protein similar to CCLS 65 [Silene latifolia] GI:2570102; contains Pfam profiles PF00514: Armadillo/beta-catenin-like repeat, PF00168: C2 domain Length = 2114 Score = 27.9 bits (59), Expect = 2.6 Identities = 13/40 (32%), Positives = 23/40 (57%) Frame = -1 Query: 169 CSSDVTDNDVVCEGDGSGSLSNDVLKGKSSGSERPQDAAE 50 CSS ++ VV EG+G ++ ++ + KS+ E D+ E Sbjct: 990 CSSHPSNRLVVMEGNGLEIIAENLQRNKSNTQENSSDSEE 1029 >At5g15130.1 68418.m01773 WRKY family transcription factor contains Pfam profile: PF03106 WRKY DNA -binding domain; TMV response-related gene product, Nicotiana tabacum, EMBL:AB024510 Length = 548 Score = 27.5 bits (58), Expect = 3.4 Identities = 13/53 (24%), Positives = 28/53 (52%) Frame = -1 Query: 193 RFDIANSYCSSDVTDNDVVCEGDGSGSLSNDVLKGKSSGSERPQDAAENADFS 35 R I+N+ ++ T+N+ C G S L ++++ +G+ Q +++ FS Sbjct: 475 RHSISNNIQQTNTTNNNKGCGGYFSSLLMSNIMASNQTGASLDQPSSQLPPFS 527 >At1g36730.1 68414.m04569 eukaryotic translation initiation factor 5, putative / eIF-5, putative similar to SP|P55876 Eukaryotic translation initiation factor 5 (eIF-5) {Zea mays}; contains Pfam profiles PF02020: eIF4-gamma/eIF5/eIF2-epsilon, PF01873: Domain found in IF2B/IF5 Length = 439 Score = 27.5 bits (58), Expect = 3.4 Identities = 20/60 (33%), Positives = 27/60 (45%) Frame = -1 Query: 220 ASEEIDLEVRFDIANSYCSSDVTDNDVVCEGDGSGSLSNDVLKGKSSGSERPQDAAENAD 41 AS E EV I Y D+ D DV+ E G S+ VLK + E Q+A ++ Sbjct: 379 ASAEAAKEVALVIKGLY-DEDILDEDVIVEWYNKGVKSSPVLKNVTPFIEWLQNAESESE 437 >At4g33300.1 68417.m04737 disease resistance protein (CC-NBS-LRR class), putative domain signature CC-NBS-LRR exists, suggestive of a disease resistance protein. Length = 816 Score = 27.1 bits (57), Expect = 4.5 Identities = 15/42 (35%), Positives = 21/42 (50%) Frame = -2 Query: 327 DDELGDVLQNTADLGCVVRQVDRDLSRKLLTAGPTSRPKRLI 202 D LG + + D+ V RDL+ L AG +R KRL+ Sbjct: 470 DPRLGSLYASHYDIFVTQHDVLRDLALHLSNAGKVNRRKRLL 511 >At4g09790.1 68417.m01608 F-box family protein hypothetical protein -Arabidopsis thaliana;PID:g2245079; contains Pfam PF00646: F-box domain; contains TIGRFAM TIGR01640: F-box protein interaction domain Length = 351 Score = 26.6 bits (56), Expect = 6.0 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = +3 Query: 306 VRRPTRHQQITVNYSNDTCESKI 374 + RP R +Q+ V Y DTC +I Sbjct: 207 MERPVREEQLAVLYQQDTCLMEI 229 >At3g20660.1 68416.m02615 organic cation transporter family protein similar to organic cation transporter OCT3 [Rattus norvegicus] GI:3273722, organic cation transporter 3 [Mus musculus] GI:4454795; contains Pfam profile PF00083: major facilitator superfamily protein Length = 534 Score = 26.6 bits (56), Expect = 6.0 Identities = 9/31 (29%), Positives = 22/31 (70%) Frame = +2 Query: 122 SVSLADNIIVSDIGAAITIGDVKSNLQINLF 214 SV+++ + + G ++ +G++K+NL +N+F Sbjct: 342 SVAISFTVSIVYYGLSLNVGNLKTNLYLNVF 372 >At1g75820.1 68414.m08807 CLAVATA1 receptor kinase (CLV1) identical to receptor kinase (CLV1) GB:AAB58929 GI:2160756 [Arabidopsis thaliana] Length = 980 Score = 26.2 bits (55), Expect = 7.9 Identities = 15/66 (22%), Positives = 30/66 (45%), Gaps = 2/66 (3%) Frame = +2 Query: 56 RVLRSFASGGLALENVVAEATASVSLADNIIVSDIGAAITIGDVKSNLQI--NLFGREVG 229 R++++ +G + + L DN ++ ++ GDV + + N F E+ Sbjct: 415 RIVKNLLNGTVPAGLFNLPLVTIIELTDNFFSGELPVTMS-GDVLDQIYLSNNWFSGEIP 473 Query: 230 PAVNNF 247 PA+ NF Sbjct: 474 PAIGNF 479 >At1g48120.1 68414.m05370 calcineurin-like phosphoesterase family protein contains Pfam profile: PF00149 calcineurin-like phosphoesterase Length = 1338 Score = 26.2 bits (55), Expect = 7.9 Identities = 12/48 (25%), Positives = 23/48 (47%), Gaps = 1/48 (2%) Frame = -1 Query: 241 VDGWSNFASEEIDLEVRFDIANSYCSSDVTDNDVV-CEGDGSGSLSND 101 +D S ++LE+ +D +++T ND C DG+ ++ D Sbjct: 1148 IDDCSTTGDAAVELEITYDEKLDRVVTEITGNDAAECMTDGNRDIATD 1195 >At1g41900.1 68414.m04840 myosin heavy chain-related similar to Myosin heavy chain, skeletal muscle, extraocular (MyHC-eo) (SP:Q9UKX3) {Homo sapiens} Length = 442 Score = 26.2 bits (55), Expect = 7.9 Identities = 18/55 (32%), Positives = 24/55 (43%) Frame = -2 Query: 231 GPTSRPKRLIWRLDLTSPIVIAAPMSLTMMLSARETEAVASATTFSRASPPEAKD 67 G S PKR + ++ S +A+P M + EA ASA RA P D Sbjct: 302 GAPSSPKRARTQPEVVSDQRVASPREERMEPATATPEAAASAIGDPRAGPMAEDD 356 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,578,421 Number of Sequences: 28952 Number of extensions: 143384 Number of successful extensions: 508 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 500 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 508 length of database: 12,070,560 effective HSP length: 74 effective length of database: 9,928,112 effective search space used: 565902384 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -