BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0793 (674 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF132969-1|AAD27744.1| 198|Homo sapiens CGI-35 protein protein. 157 3e-38 BC080600-1|AAH80600.1| 109|Homo sapiens FCF1 protein protein. 83 7e-16 BC022441-1|AAH22441.1| 249|Homo sapiens chromosome 8 open readi... 39 0.019 BC005955-1|AAH05955.1| 249|Homo sapiens chromosome 8 open readi... 39 0.019 AK055279-1|BAB70896.1| 145|Homo sapiens protein ( Homo sapiens ... 39 0.019 BC117389-1|AAI17390.1| 499|Homo sapiens PRP31 pre-mRNA processi... 34 0.53 AY040822-1|AAK77986.1| 499|Homo sapiens U4/U6 snRNP-associated ... 34 0.53 AK098547-1|BAC05329.1| 364|Homo sapiens protein ( Homo sapiens ... 34 0.53 AF308303-1|AAG48270.1| 278|Homo sapiens serologically defined b... 34 0.53 CR533468-1|CAG38499.1| 182|Homo sapiens VPS29 protein. 33 1.2 CR457182-1|CAG33463.1| 186|Homo sapiens VPS29 protein. 33 1.2 BC095446-1|AAH95446.1| 182|Homo sapiens vacuolar protein sortin... 33 1.2 BC000880-1|AAH00880.1| 186|Homo sapiens vacuolar protein sortin... 33 1.2 AF201946-1|AAF17238.1| 182|Homo sapiens DC7 protein protein. 33 1.2 AF201936-1|AAF86872.1| 188|Homo sapiens DC15 protein. 33 1.2 AF193795-1|AAF04596.1| 182|Homo sapiens vacuolar sorting protei... 33 1.2 AF175264-1|AAF89952.1| 182|Homo sapiens vacuolar sorting protei... 33 1.2 AF168716-1|AAF87318.1| 186|Homo sapiens x 007 protein protein. 33 1.2 Z97630-1|CAB42829.1| 194|Homo sapiens H1 histone family, member... 30 8.6 Z93024-4|CAI18792.1| 2253|Homo sapiens polycystic kidney disease... 30 8.6 X03473-1|CAA27190.1| 194|Homo sapiens protein ( Human gene for ... 30 8.6 EF517278-1|ABR22603.1| 2255|Homo sapiens PKDREJ protein. 30 8.6 CR542220-1|CAG47016.1| 194|Homo sapiens H1F0 protein. 30 8.6 CR456502-1|CAG30388.1| 194|Homo sapiens H1F0 protein. 30 8.6 BC029046-1|AAH29046.1| 194|Homo sapiens H1 histone family, memb... 30 8.6 BC000145-1|AAH00145.1| 194|Homo sapiens H1 histone family, memb... 30 8.6 AL078611-3|CAI18766.1| 2253|Homo sapiens polycystic kidney disea... 30 8.6 AL031034-1|CAI18795.1| 2253|Homo sapiens polycystic kidney disea... 30 8.6 AF116458-1|AAD18021.1| 2253|Homo sapiens polycystic kidney disea... 30 8.6 >AF132969-1|AAD27744.1| 198|Homo sapiens CGI-35 protein protein. Length = 198 Score = 157 bits (382), Expect = 3e-38 Identities = 69/85 (81%), Positives = 77/85 (90%) Frame = +3 Query: 255 EVPQTSSALFFQYNMQLGPPYHVLIDTNFINFSIKNKLDIIQNMMDCLYAKCIPYITDCV 434 EVPQ S LFFQYN QLGPPYH+L+DTNFINFSIK KLD++Q+MMDCLYAKCIP ITDCV Sbjct: 47 EVPQHPSCLFFQYNTQLGPPYHILVDTNFINFSIKAKLDLVQSMMDCLYAKCIPCITDCV 106 Query: 435 LGELEKLGRKYRVALRIIKDPRFER 509 + E+EKLG+KYRVALRI KDPRFER Sbjct: 107 MAEIEKLGQKYRVALRIAKDPRFER 131 Score = 80.6 bits (190), Expect = 5e-15 Identities = 38/61 (62%), Positives = 44/61 (72%) Frame = +2 Query: 443 IGKTWKKV*SSFKDYQGPTI*EIACLHKGTYADDCLVQRVTQHKCYIVATNDKDLKRRIR 622 I K +K + + + P + C HKGTYADDCLVQRVTQHKCYIVAT D+DLKRRIR Sbjct: 110 IEKLGQKYRVALRIAKDPRFERLPCTHKGTYADDCLVQRVTQHKCYIVATVDRDLKRRIR 169 Query: 623 K 625 K Sbjct: 170 K 170 Score = 51.6 bits (118), Expect = 2e-06 Identities = 29/75 (38%), Positives = 42/75 (56%), Gaps = 2/75 (2%) Frame = +1 Query: 103 MGKQRKTRKIVEKRFAKMKKMINPSDSRIKNSERSEPKKKKPVDPHVIKIRK--SHKQVP 276 MGKQ+KTRK +A MK+M++ D R+K +R +PKKK+ DP +K R+ H Sbjct: 1 MGKQKKTRK-----YATMKRMLSLRDQRLKEKDRLKPKKKEKKDPSALKEREVPQHPSCL 55 Query: 277 HYSSNTTCS*DRHIM 321 + NT HI+ Sbjct: 56 FFQYNTQLGPPYHIL 70 Score = 33.9 bits (74), Expect = 0.53 Identities = 12/17 (70%), Positives = 15/17 (88%) Frame = +1 Query: 622 KIPGVPIMYVAEHKYTI 672 KIPGVPIMY++ H+Y I Sbjct: 170 KIPGVPIMYISNHRYNI 186 >BC080600-1|AAH80600.1| 109|Homo sapiens FCF1 protein protein. Length = 109 Score = 83.4 bits (197), Expect = 7e-16 Identities = 36/42 (85%), Positives = 39/42 (92%) Frame = +3 Query: 384 MMDCLYAKCIPYITDCVLGELEKLGRKYRVALRIIKDPRFER 509 MMDCLYAKCIP ITDCV+ E+EKLG+KYRVALRI KDPRFER Sbjct: 1 MMDCLYAKCIPCITDCVMAEIEKLGQKYRVALRIAKDPRFER 42 Score = 80.6 bits (190), Expect = 5e-15 Identities = 38/61 (62%), Positives = 44/61 (72%) Frame = +2 Query: 443 IGKTWKKV*SSFKDYQGPTI*EIACLHKGTYADDCLVQRVTQHKCYIVATNDKDLKRRIR 622 I K +K + + + P + C HKGTYADDCLVQRVTQHKCYIVAT D+DLKRRIR Sbjct: 21 IEKLGQKYRVALRIAKDPRFERLPCTHKGTYADDCLVQRVTQHKCYIVATVDRDLKRRIR 80 Query: 623 K 625 K Sbjct: 81 K 81 Score = 33.9 bits (74), Expect = 0.53 Identities = 12/17 (70%), Positives = 15/17 (88%) Frame = +1 Query: 622 KIPGVPIMYVAEHKYTI 672 KIPGVPIMY++ H+Y I Sbjct: 81 KIPGVPIMYISNHRYNI 97 >BC022441-1|AAH22441.1| 249|Homo sapiens chromosome 8 open reading frame 53 protein. Length = 249 Score = 38.7 bits (86), Expect = 0.019 Identities = 18/60 (30%), Positives = 32/60 (53%) Frame = +3 Query: 282 FFQYNMQLGPPYHVLIDTNFINFSIKNKLDIIQNMMDCLYAKCIPYITDCVLGELEKLGR 461 FF+ N + PY +L+D F +++ ++ + + + L + T CVL ELE LG+ Sbjct: 15 FFRNNFGVREPYQILLDGTFCQAALRGRIQLREQLPRYLMGETQLCTTRCVLKELETLGK 74 >BC005955-1|AAH05955.1| 249|Homo sapiens chromosome 8 open reading frame 53 protein. Length = 249 Score = 38.7 bits (86), Expect = 0.019 Identities = 18/60 (30%), Positives = 32/60 (53%) Frame = +3 Query: 282 FFQYNMQLGPPYHVLIDTNFINFSIKNKLDIIQNMMDCLYAKCIPYITDCVLGELEKLGR 461 FF+ N + PY +L+D F +++ ++ + + + L + T CVL ELE LG+ Sbjct: 15 FFRNNFGVREPYQILLDGTFCQAALRGRIQLREQLPRYLMGETQLCTTRCVLKELETLGK 74 >AK055279-1|BAB70896.1| 145|Homo sapiens protein ( Homo sapiens cDNA FLJ30717 fis, clone FCBBF2001672. ). Length = 145 Score = 38.7 bits (86), Expect = 0.019 Identities = 18/60 (30%), Positives = 32/60 (53%) Frame = +3 Query: 282 FFQYNMQLGPPYHVLIDTNFINFSIKNKLDIIQNMMDCLYAKCIPYITDCVLGELEKLGR 461 FF+ N + PY +L+D F +++ ++ + + + L + T CVL ELE LG+ Sbjct: 15 FFRNNFGVREPYQILLDGTFCQAALRGRIQLREQLPRYLMGETQLCTTRCVLKELETLGK 74 >BC117389-1|AAI17390.1| 499|Homo sapiens PRP31 pre-mRNA processing factor 31 homolog (S. cerevisiae) protein. Length = 499 Score = 33.9 bits (74), Expect = 0.53 Identities = 15/51 (29%), Positives = 27/51 (52%) Frame = +3 Query: 297 MQLGPPYHVLIDTNFINFSIKNKLDIIQNMMDCLYAKCIPYITDCVLGELE 449 ++ P Y V++D N + I+N+L+II + Y+K P + V L+ Sbjct: 84 VEAAPEYRVIVDANNLTVEIENELNIIHKFIRDKYSKRFPELESLVPNALD 134 >AY040822-1|AAK77986.1| 499|Homo sapiens U4/U6 snRNP-associated 61 kDa protein protein. Length = 499 Score = 33.9 bits (74), Expect = 0.53 Identities = 15/51 (29%), Positives = 27/51 (52%) Frame = +3 Query: 297 MQLGPPYHVLIDTNFINFSIKNKLDIIQNMMDCLYAKCIPYITDCVLGELE 449 ++ P Y V++D N + I+N+L+II + Y+K P + V L+ Sbjct: 84 VEAAPEYRVIVDANNLTVEIENELNIIHKFIRDKYSKRFPELESLVPNALD 134 >AK098547-1|BAC05329.1| 364|Homo sapiens protein ( Homo sapiens cDNA FLJ25681 fis, clone TST04131. ). Length = 364 Score = 33.9 bits (74), Expect = 0.53 Identities = 15/51 (29%), Positives = 27/51 (52%) Frame = +3 Query: 297 MQLGPPYHVLIDTNFINFSIKNKLDIIQNMMDCLYAKCIPYITDCVLGELE 449 ++ P Y V++D N + I+N+L+II + Y+K P + V L+ Sbjct: 84 VEAAPEYRVIVDANNLTVEIENELNIIHKFIRDKYSKRFPELESLVPNALD 134 >AF308303-1|AAG48270.1| 278|Homo sapiens serologically defined breast cancer antigen NY-BR-99 protein. Length = 278 Score = 33.9 bits (74), Expect = 0.53 Identities = 15/51 (29%), Positives = 27/51 (52%) Frame = +3 Query: 297 MQLGPPYHVLIDTNFINFSIKNKLDIIQNMMDCLYAKCIPYITDCVLGELE 449 ++ P Y V++D N + I+N+L+II + Y+K P + V L+ Sbjct: 4 VEAAPEYRVIVDANNLTVEIENELNIIHKFIRDKYSKRFPELESLVPNALD 54 >CR533468-1|CAG38499.1| 182|Homo sapiens VPS29 protein. Length = 182 Score = 32.7 bits (71), Expect = 1.2 Identities = 17/47 (36%), Positives = 25/47 (53%), Gaps = 1/47 (2%) Frame = -3 Query: 666 ILVFRNIHYRHTWYFLILRFKSLSLVATI*HLCCV-TLCTKQSSAYV 529 +LV ++H H L +FK L + I H+ C LCTK+S Y+ Sbjct: 3 VLVLGDLHIPHRCNSLPAKFKKLLVPGKIQHILCTGNLCTKESYDYL 49 >CR457182-1|CAG33463.1| 186|Homo sapiens VPS29 protein. Length = 186 Score = 32.7 bits (71), Expect = 1.2 Identities = 17/47 (36%), Positives = 25/47 (53%), Gaps = 1/47 (2%) Frame = -3 Query: 666 ILVFRNIHYRHTWYFLILRFKSLSLVATI*HLCCV-TLCTKQSSAYV 529 +LV ++H H L +FK L + I H+ C LCTK+S Y+ Sbjct: 7 VLVLGDLHIPHRCNSLPAKFKKLLVPGKIQHILCTGNLCTKESYDYL 53 >BC095446-1|AAH95446.1| 182|Homo sapiens vacuolar protein sorting 29 homolog (S. cerevisiae) protein. Length = 182 Score = 32.7 bits (71), Expect = 1.2 Identities = 17/47 (36%), Positives = 25/47 (53%), Gaps = 1/47 (2%) Frame = -3 Query: 666 ILVFRNIHYRHTWYFLILRFKSLSLVATI*HLCCV-TLCTKQSSAYV 529 +LV ++H H L +FK L + I H+ C LCTK+S Y+ Sbjct: 3 VLVLGDLHIPHRCNSLPAKFKKLLVPGKIQHILCTGNLCTKESYDYL 49 >BC000880-1|AAH00880.1| 186|Homo sapiens vacuolar protein sorting 29 homolog (S. cerevisiae) protein. Length = 186 Score = 32.7 bits (71), Expect = 1.2 Identities = 17/47 (36%), Positives = 25/47 (53%), Gaps = 1/47 (2%) Frame = -3 Query: 666 ILVFRNIHYRHTWYFLILRFKSLSLVATI*HLCCV-TLCTKQSSAYV 529 +LV ++H H L +FK L + I H+ C LCTK+S Y+ Sbjct: 7 VLVLGDLHIPHRCNSLPAKFKKLLVPGKIQHILCTGNLCTKESYDYL 53 >AF201946-1|AAF17238.1| 182|Homo sapiens DC7 protein protein. Length = 182 Score = 32.7 bits (71), Expect = 1.2 Identities = 17/47 (36%), Positives = 25/47 (53%), Gaps = 1/47 (2%) Frame = -3 Query: 666 ILVFRNIHYRHTWYFLILRFKSLSLVATI*HLCCV-TLCTKQSSAYV 529 +LV ++H H L +FK L + I H+ C LCTK+S Y+ Sbjct: 3 VLVLGDLHIPHRCNSLPAKFKKLLVPGKIQHILCTGNLCTKESYDYL 49 >AF201936-1|AAF86872.1| 188|Homo sapiens DC15 protein. Length = 188 Score = 32.7 bits (71), Expect = 1.2 Identities = 17/47 (36%), Positives = 25/47 (53%), Gaps = 1/47 (2%) Frame = -3 Query: 666 ILVFRNIHYRHTWYFLILRFKSLSLVATI*HLCCV-TLCTKQSSAYV 529 +LV ++H H L +FK L + I H+ C LCTK+S Y+ Sbjct: 9 VLVLGDLHIPHRCNSLPAKFKKLLVPGKIQHILCTGNLCTKESYDYL 55 >AF193795-1|AAF04596.1| 182|Homo sapiens vacuolar sorting protein VPS29/PEP11 protein. Length = 182 Score = 32.7 bits (71), Expect = 1.2 Identities = 17/47 (36%), Positives = 25/47 (53%), Gaps = 1/47 (2%) Frame = -3 Query: 666 ILVFRNIHYRHTWYFLILRFKSLSLVATI*HLCCV-TLCTKQSSAYV 529 +LV ++H H L +FK L + I H+ C LCTK+S Y+ Sbjct: 3 VLVLGDLHIPHRCNSLPAKFKKLLVPGKIQHILCTGNLCTKESYDYL 49 >AF175264-1|AAF89952.1| 182|Homo sapiens vacuolar sorting protein 29 protein. Length = 182 Score = 32.7 bits (71), Expect = 1.2 Identities = 17/47 (36%), Positives = 25/47 (53%), Gaps = 1/47 (2%) Frame = -3 Query: 666 ILVFRNIHYRHTWYFLILRFKSLSLVATI*HLCCV-TLCTKQSSAYV 529 +LV ++H H L +FK L + I H+ C LCTK+S Y+ Sbjct: 3 VLVLGDLHIPHRCNSLPAKFKKLLVPGKIQHILCTGNLCTKESYDYL 49 >AF168716-1|AAF87318.1| 186|Homo sapiens x 007 protein protein. Length = 186 Score = 32.7 bits (71), Expect = 1.2 Identities = 17/47 (36%), Positives = 25/47 (53%), Gaps = 1/47 (2%) Frame = -3 Query: 666 ILVFRNIHYRHTWYFLILRFKSLSLVATI*HLCCV-TLCTKQSSAYV 529 +LV ++H H L +FK L + I H+ C LCTK+S Y+ Sbjct: 7 VLVLGDLHIPHRCNSLPAKFKKLLVPGKIQHILCTGNLCTKESYDYL 53 >Z97630-1|CAB42829.1| 194|Homo sapiens H1 histone family, member 0 protein. Length = 194 Score = 29.9 bits (64), Expect = 8.6 Identities = 16/43 (37%), Positives = 21/43 (48%) Frame = +1 Query: 109 KQRKTRKIVEKRFAKMKKMINPSDSRIKNSERSEPKKKKPVDP 237 K +K +K A KK P + K + S+PKK KPV P Sbjct: 139 KATPVKKAKKKLAATPKKAKKPKTVKAKPVKASKPKKAKPVKP 181 >Z93024-4|CAI18792.1| 2253|Homo sapiens polycystic kidney disease (polycystin) and REJ homolog (sperm receptor for egg protein. Length = 2253 Score = 29.9 bits (64), Expect = 8.6 Identities = 16/51 (31%), Positives = 25/51 (49%) Frame = -2 Query: 631 LVFSNSSFQIFVIGSYNITFMLCNSLY*TIISICTFVKTCYLSNRGSLIIL 479 LVF+ SS F I Y +T+ S+ S C+F ++ L +I+L Sbjct: 1583 LVFATSSISSFFIVFYGLTYGYDKSIEWLFASFCSFCQSVLLVQPSKIILL 1633 >X03473-1|CAA27190.1| 194|Homo sapiens protein ( Human gene for histone H1(0). ). Length = 194 Score = 29.9 bits (64), Expect = 8.6 Identities = 16/43 (37%), Positives = 21/43 (48%) Frame = +1 Query: 109 KQRKTRKIVEKRFAKMKKMINPSDSRIKNSERSEPKKKKPVDP 237 K +K +K A KK P + K + S+PKK KPV P Sbjct: 139 KATPVKKAKKKLAATPKKAKKPKTVKAKPVKASKPKKAKPVKP 181 >EF517278-1|ABR22603.1| 2255|Homo sapiens PKDREJ protein. Length = 2255 Score = 29.9 bits (64), Expect = 8.6 Identities = 16/51 (31%), Positives = 25/51 (49%) Frame = -2 Query: 631 LVFSNSSFQIFVIGSYNITFMLCNSLY*TIISICTFVKTCYLSNRGSLIIL 479 LVF+ SS F I Y +T+ S+ S C+F ++ L +I+L Sbjct: 1585 LVFATSSISSFFIVFYGLTYGYDKSIEWLFASFCSFCQSVLLVQPSKIILL 1635 >CR542220-1|CAG47016.1| 194|Homo sapiens H1F0 protein. Length = 194 Score = 29.9 bits (64), Expect = 8.6 Identities = 16/43 (37%), Positives = 21/43 (48%) Frame = +1 Query: 109 KQRKTRKIVEKRFAKMKKMINPSDSRIKNSERSEPKKKKPVDP 237 K +K +K A KK P + K + S+PKK KPV P Sbjct: 139 KATPVKKAKKKLAATPKKAKKPKTVKAKPVKASKPKKAKPVKP 181 >CR456502-1|CAG30388.1| 194|Homo sapiens H1F0 protein. Length = 194 Score = 29.9 bits (64), Expect = 8.6 Identities = 16/43 (37%), Positives = 21/43 (48%) Frame = +1 Query: 109 KQRKTRKIVEKRFAKMKKMINPSDSRIKNSERSEPKKKKPVDP 237 K +K +K A KK P + K + S+PKK KPV P Sbjct: 139 KATPVKKAKKKLAATPKKAKKPKTVKAKPVKASKPKKAKPVKP 181 >BC029046-1|AAH29046.1| 194|Homo sapiens H1 histone family, member 0 protein. Length = 194 Score = 29.9 bits (64), Expect = 8.6 Identities = 16/43 (37%), Positives = 21/43 (48%) Frame = +1 Query: 109 KQRKTRKIVEKRFAKMKKMINPSDSRIKNSERSEPKKKKPVDP 237 K +K +K A KK P + K + S+PKK KPV P Sbjct: 139 KATPVKKAKKKLAATPKKAKKPKTVKAKPVKASKPKKAKPVKP 181 >BC000145-1|AAH00145.1| 194|Homo sapiens H1 histone family, member 0 protein. Length = 194 Score = 29.9 bits (64), Expect = 8.6 Identities = 16/43 (37%), Positives = 21/43 (48%) Frame = +1 Query: 109 KQRKTRKIVEKRFAKMKKMINPSDSRIKNSERSEPKKKKPVDP 237 K +K +K A KK P + K + S+PKK KPV P Sbjct: 139 KATPVKKAKKKLAATPKKAKKPKTVKAKPVKASKPKKAKPVKP 181 >AL078611-3|CAI18766.1| 2253|Homo sapiens polycystic kidney disease (polycystin) and REJ homolog (sperm receptor for egg protein. Length = 2253 Score = 29.9 bits (64), Expect = 8.6 Identities = 16/51 (31%), Positives = 25/51 (49%) Frame = -2 Query: 631 LVFSNSSFQIFVIGSYNITFMLCNSLY*TIISICTFVKTCYLSNRGSLIIL 479 LVF+ SS F I Y +T+ S+ S C+F ++ L +I+L Sbjct: 1583 LVFATSSISSFFIVFYGLTYGYDKSIEWLFASFCSFCQSVLLVQPSKIILL 1633 >AL031034-1|CAI18795.1| 2253|Homo sapiens polycystic kidney disease (polycystin) and REJ homolog (sperm receptor for egg protein. Length = 2253 Score = 29.9 bits (64), Expect = 8.6 Identities = 16/51 (31%), Positives = 25/51 (49%) Frame = -2 Query: 631 LVFSNSSFQIFVIGSYNITFMLCNSLY*TIISICTFVKTCYLSNRGSLIIL 479 LVF+ SS F I Y +T+ S+ S C+F ++ L +I+L Sbjct: 1583 LVFATSSISSFFIVFYGLTYGYDKSIEWLFASFCSFCQSVLLVQPSKIILL 1633 >AF116458-1|AAD18021.1| 2253|Homo sapiens polycystic kidney disease and receptor for egg jelly related protein protein. Length = 2253 Score = 29.9 bits (64), Expect = 8.6 Identities = 16/51 (31%), Positives = 25/51 (49%) Frame = -2 Query: 631 LVFSNSSFQIFVIGSYNITFMLCNSLY*TIISICTFVKTCYLSNRGSLIIL 479 LVF+ SS F I Y +T+ S+ S C+F ++ L +I+L Sbjct: 1583 LVFATSSISSFFIVFYGLTYGYDKSIEWLFASFCSFCQSVLLVQPSKIILL 1633 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 94,515,188 Number of Sequences: 237096 Number of extensions: 2002932 Number of successful extensions: 3749 Number of sequences better than 10.0: 29 Number of HSP's better than 10.0 without gapping: 3594 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3748 length of database: 76,859,062 effective HSP length: 88 effective length of database: 55,994,614 effective search space used: 7615267504 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -