BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0792 (738 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY316682-1|AAQ83696.1| 456|Tribolium castaneum Sp-like zinc fin... 28 0.068 DQ659252-1|ABG47450.1| 377|Tribolium castaneum chitinase 13 pro... 23 1.9 AF260820-1|AAG02018.1| 139|Tribolium castaneum alpha-esterase l... 22 4.5 DQ855505-1|ABH88192.1| 119|Tribolium castaneum chemosensory pro... 22 5.9 AF225975-2|AAF74116.1| 302|Tribolium castaneum Tc-tailless prot... 22 5.9 AF219117-1|AAF71999.1| 406|Tribolium castaneum tailless ortholo... 22 5.9 AF025669-1|AAB81523.1| 243|Tribolium castaneum GABA receptor su... 21 7.9 >AY316682-1|AAQ83696.1| 456|Tribolium castaneum Sp-like zinc finger protein protein. Length = 456 Score = 28.3 bits (60), Expect = 0.068 Identities = 20/75 (26%), Positives = 32/75 (42%), Gaps = 1/75 (1%) Frame = -2 Query: 488 CPEHRQTQRVGPWKPHLRHPARKHDRHLAGIAETSRR*WRRKSYSGRMASSLGRVRQGPS 309 CP ++ +R+GP HLR H H+ G + + K++ V Sbjct: 293 CPNCQEAERLGPAGVHLR-KKNIHSCHIPGCGKVYGKTSHLKAHLRWHTGERPFVCNWLF 351 Query: 308 CSKRLAKS-SVQKHL 267 C KR +S +Q+HL Sbjct: 352 CGKRFTRSDELQRHL 366 >DQ659252-1|ABG47450.1| 377|Tribolium castaneum chitinase 13 protein. Length = 377 Score = 23.4 bits (48), Expect = 1.9 Identities = 8/21 (38%), Positives = 14/21 (66%), Gaps = 1/21 (4%) Frame = +1 Query: 577 FGHHFVVTEPDQ-DRNDGAGA 636 +GHHF++++P + ND A Sbjct: 258 YGHHFILSDPSKHGLNDATAA 278 >AF260820-1|AAG02018.1| 139|Tribolium castaneum alpha-esterase like protein E1 protein. Length = 139 Score = 22.2 bits (45), Expect = 4.5 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = -3 Query: 190 IRTKAPRPLKNWLKV 146 +R KAP+P +NW V Sbjct: 14 LRFKAPQPPENWTGV 28 >DQ855505-1|ABH88192.1| 119|Tribolium castaneum chemosensory protein 19 protein. Length = 119 Score = 21.8 bits (44), Expect = 5.9 Identities = 7/14 (50%), Positives = 10/14 (71%) Frame = -2 Query: 119 QELWKEYFSSDDPD 78 Q++WKE + DPD Sbjct: 93 QQMWKELTAKYDPD 106 >AF225975-2|AAF74116.1| 302|Tribolium castaneum Tc-tailless protein. Length = 302 Score = 21.8 bits (44), Expect = 5.9 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = +2 Query: 353 LSNFSVSISVGLFLQSQPDGDHAFLQDV 436 L +FSV + LQ +P AFL++V Sbjct: 250 LMDFSVLVEACGVLQQEPHRRDAFLKEV 277 >AF219117-1|AAF71999.1| 406|Tribolium castaneum tailless ortholog protein. Length = 406 Score = 21.8 bits (44), Expect = 5.9 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = +2 Query: 353 LSNFSVSISVGLFLQSQPDGDHAFLQDV 436 L +FSV + LQ +P AFL++V Sbjct: 250 LMDFSVLVEACGVLQQEPHRRDAFLKEV 277 >AF025669-1|AAB81523.1| 243|Tribolium castaneum GABA receptor subunit protein. Length = 243 Score = 21.4 bits (43), Expect = 7.9 Identities = 10/37 (27%), Positives = 21/37 (56%) Frame = -1 Query: 546 TVFFDSDKSGVVENKTLNWLPRTSPNSEGGPLEAPPT 436 +V D + S ++++ ++++ R PN G P+E T Sbjct: 34 SVLGDVNISAILDSFSVSYDKRVRPNYGGPPVEVGVT 70 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 179,038 Number of Sequences: 336 Number of extensions: 4135 Number of successful extensions: 9 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 19779950 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -