BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0790 (684 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_UPI000061078F Cluster: Interleukin-20 receptor alpha ch... 34 3.7 UniRef50_A2WY74 Cluster: Putative uncharacterized protein; n=2; ... 34 3.7 UniRef50_P47465 Cluster: Uncharacterized protein MG223; n=2; Myc... 33 6.5 >UniRef50_UPI000061078F Cluster: Interleukin-20 receptor alpha chain precursor (IL-20R-alpha) (IL-20R1) (Cytokine receptor family 2 member 8) (Cytokine receptor class-II member 8) (CRF2-8) (ZcytoR7).; n=2; Gallus gallus|Rep: Interleukin-20 receptor alpha chain precursor (IL-20R-alpha) (IL-20R1) (Cytokine receptor family 2 member 8) (Cytokine receptor class-II member 8) (CRF2-8) (ZcytoR7). - Gallus gallus Length = 519 Score = 33.9 bits (74), Expect = 3.7 Identities = 20/70 (28%), Positives = 35/70 (50%) Frame = +3 Query: 60 KQLYFTFNTKLLL*NDWLESGTYYSN*SKIYIDLFI*LKGFSSDCCIVQFSSFTTKGRTP 239 K+ +F+ + L+ WLE GT Y ++I++ + GFS + CI TT Sbjct: 155 KRWFFSISNSTLV-VPWLEPGTAYCVSAQIHVTTPLLHSGFSKEHCISTLKDKTTDETIT 213 Query: 240 VVFWGVVTLI 269 VVF ++ ++ Sbjct: 214 VVFGYILPIV 223 >UniRef50_A2WY74 Cluster: Putative uncharacterized protein; n=2; Oryza sativa|Rep: Putative uncharacterized protein - Oryza sativa subsp. indica (Rice) Length = 593 Score = 33.9 bits (74), Expect = 3.7 Identities = 11/18 (61%), Positives = 14/18 (77%) Frame = -2 Query: 620 SKKKSQYCNGIHCKCQNI 567 S+K SQ C G+HCKCQ + Sbjct: 227 SEKSSQICTGVHCKCQQL 244 >UniRef50_P47465 Cluster: Uncharacterized protein MG223; n=2; Mycoplasma genitalium|Rep: Uncharacterized protein MG223 - Mycoplasma genitalium Length = 411 Score = 33.1 bits (72), Expect = 6.5 Identities = 15/51 (29%), Positives = 31/51 (60%) Frame = +3 Query: 360 SYNTN*NSSIYFYSTKLNLLGSLKIFEHLKIKIKVNEIRVLNHHCLNSENL 512 ++N + +++ YS+K NL+G LK F + +KV ++++HH + +L Sbjct: 146 AFNKSYVANLVAYSSKSNLIGELKFFLKRNVNLKVK--KIISHHLALANSL 194 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 551,211,193 Number of Sequences: 1657284 Number of extensions: 9582655 Number of successful extensions: 17735 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 17284 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 17735 length of database: 575,637,011 effective HSP length: 98 effective length of database: 413,223,179 effective search space used: 53305790091 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -