BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0788 (781 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY819656-1|AAV70656.1| 56|Tribolium castaneum elongation facto... 71 1e-14 AJ223627-1|CAA11500.1| 371|Tribolium castaneum orthodenticle-1 ... 25 0.90 AM292380-1|CAL23192.2| 489|Tribolium castaneum gustatory recept... 23 3.6 DQ659247-1|ABG47445.1| 980|Tribolium castaneum chitinase 7 prot... 22 4.8 EF222291-1|ABN79651.1| 374|Tribolium castaneum cardioactive pep... 22 6.3 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 22 6.3 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 22 6.3 >AY819656-1|AAV70656.1| 56|Tribolium castaneum elongation factor 1-alpha protein. Length = 56 Score = 70.5 bits (165), Expect = 1e-14 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = +1 Query: 409 LQDVYKIGGIGTVPVGRVETGVLKPGTIVVFAPA 510 LQDVYKIGGIGTVPVGRVETGVLKPG +VVFAPA Sbjct: 1 LQDVYKIGGIGTVPVGRVETGVLKPGMVVVFAPA 34 Score = 49.2 bits (112), Expect = 4e-08 Identities = 22/24 (91%), Positives = 22/24 (91%) Frame = +3 Query: 504 PRNITTEVKSVEMHHEALQEAVPG 575 P NITTEVKSVEMHHEAL EAVPG Sbjct: 33 PANITTEVKSVEMHHEALPEAVPG 56 >AJ223627-1|CAA11500.1| 371|Tribolium castaneum orthodenticle-1 protein protein. Length = 371 Score = 24.6 bits (51), Expect = 0.90 Identities = 11/24 (45%), Positives = 16/24 (66%), Gaps = 1/24 (4%) Frame = -2 Query: 477 QHTSFN-SADGHGTNTTDFVYVLQ 409 ++ SFN +A+GHG NT+ Y Q Sbjct: 280 EYNSFNWTANGHGHNTSSHNYYAQ 303 >AM292380-1|CAL23192.2| 489|Tribolium castaneum gustatory receptor candidate 59 protein. Length = 489 Score = 22.6 bits (46), Expect = 3.6 Identities = 8/16 (50%), Positives = 11/16 (68%) Frame = +3 Query: 498 LCPRNITTEVKSVEMH 545 LCPR+I ++K E H Sbjct: 22 LCPRSIDEKIKRQERH 37 >DQ659247-1|ABG47445.1| 980|Tribolium castaneum chitinase 7 protein. Length = 980 Score = 22.2 bits (45), Expect = 4.8 Identities = 8/23 (34%), Positives = 12/23 (52%) Frame = +1 Query: 229 FRAHFWMARDNMLEPSTKMPWFK 297 +R + W+ D+ TKM W K Sbjct: 825 YRGNQWVGFDDERSLKTKMAWLK 847 >EF222291-1|ABN79651.1| 374|Tribolium castaneum cardioactive peptide receptor 1 protein. Length = 374 Score = 21.8 bits (44), Expect = 6.3 Identities = 12/39 (30%), Positives = 18/39 (46%) Frame = -3 Query: 602 VLYVETYIVSRYSFLESFVVHLHRLDFSSDVAGAKTTMV 486 VLY + SR S + F+ HL D S + T ++ Sbjct: 45 VLYTLLFGRSRKSRMNYFITHLALADLSVGLINVLTDII 83 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 21.8 bits (44), Expect = 6.3 Identities = 14/43 (32%), Positives = 21/43 (48%) Frame = -1 Query: 232 ESDSSWVVANLLDV*GYFLLDFLKSGLTVWWFSGIHFVYSYDE 104 +S ++ + N L V FLL K L + W G+ +YDE Sbjct: 1267 QSVFAFFMMNALFVLIVFLLTLKKDYLHIKWPFGVKTNITYDE 1309 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 21.8 bits (44), Expect = 6.3 Identities = 14/43 (32%), Positives = 21/43 (48%) Frame = -1 Query: 232 ESDSSWVVANLLDV*GYFLLDFLKSGLTVWWFSGIHFVYSYDE 104 +S ++ + N L V FLL K L + W G+ +YDE Sbjct: 1267 QSVFAFFMMNALFVLIVFLLTLKKDYLHIKWPFGVKTNITYDE 1309 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 214,449 Number of Sequences: 336 Number of extensions: 5165 Number of successful extensions: 12 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 21065107 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -