BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0786 (708 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g16080.1 68418.m01879 expressed protein similar to PrMC3 [Pin... 38 0.009 At5g06570.2 68418.m00742 expressed protein similar to PrMC3 [Pin... 38 0.009 At5g06570.1 68418.m00741 expressed protein similar to PrMC3 [Pin... 38 0.009 At1g47480.1 68414.m05267 expressed protein similar to PrMC3 [Pin... 35 0.061 At1g68620.1 68414.m07841 expressed protein similar to PrMC3 [Pin... 33 0.25 At1g26120.1 68414.m03188 esterase-related contains similaity to ... 33 0.25 At3g63010.1 68416.m07078 expressed protein similar to PrMC3 [Pin... 32 0.32 At3g02410.1 68416.m00228 hypothetical protein weak similarity to... 32 0.32 At5g27320.1 68418.m03262 expressed protein similar to PrMC3 [Pin... 32 0.43 At2g03550.1 68415.m00315 expressed protein similar to PrMC3 [Pin... 31 0.57 At3g48700.1 68416.m05318 expressed protein similar to PrMC3 [Pin... 31 0.75 At5g15860.2 68418.m01856 expressed protein 31 0.99 At5g15860.1 68418.m01855 expressed protein 31 0.99 At1g19190.1 68414.m02389 expressed protein contains similarity t... 31 0.99 At3g05120.1 68416.m00556 expressed protein low similarity to PrM... 30 1.3 At3g48690.1 68416.m05317 expressed protein similar to PrMC3 [Pin... 30 1.7 At1g49640.1 68414.m05567 hypothetical protein similar to PrMC3 [... 30 1.7 At5g23530.1 68418.m02761 expressed protein contains similarity t... 29 2.3 At5g14310.1 68418.m01673 expressed protein low similarity to PrM... 29 2.3 At3g14960.1 68416.m01892 galactosyltransferase family protein co... 29 2.3 At2g45600.1 68415.m05670 expressed protein low similarity to PrM... 29 4.0 At2g41530.1 68415.m05132 esterase, putative similar to SP|P10768... 29 4.0 At3g05690.1 68416.m00636 CCAAT-binding transcription factor (CBF... 28 5.3 At5g61990.1 68418.m07780 pentatricopeptide (PPR) repeat-containi... 28 7.0 At4g29490.1 68417.m04208 Xaa-Pro dipeptidase, putative / prolida... 28 7.0 At4g23760.1 68417.m03418 expressed protein 28 7.0 At2g06025.1 68415.m00659 GCN5-related N-acetyltransferase (GNAT)... 28 7.0 At4g18250.1 68417.m02710 receptor serine/threonine kinase, putat... 27 9.2 At4g04930.1 68417.m00717 fatty acid desaturase family protein si... 27 9.2 At2g45470.1 68415.m05655 fasciclin-like arabinogalactan-protein ... 27 9.2 At1g78950.1 68414.m09204 beta-amyrin synthase, putative similar ... 27 9.2 >At5g16080.1 68418.m01879 expressed protein similar to PrMC3 [Pinus radiata] GI:5487873 Length = 344 Score = 37.5 bits (83), Expect = 0.009 Identities = 24/77 (31%), Positives = 38/77 (49%), Gaps = 5/77 (6%) Frame = +1 Query: 10 TKPLAYYIGTIDCLHLNVYVPPSATSKNPV--PVMVYIYGGSFRHGDFG---RHVYGPKF 174 +K A+ I + VY+P +A + V P++VY +GG F G H + Sbjct: 61 SKATAFDIKLSNDTWTRVYIPDAAAASPSVTLPLLVYFHGGGFCVGSAAWSCYHDFLTSL 120 Query: 175 LVKHDVILVTLNYRLGP 225 VK ++V++NYRL P Sbjct: 121 AVKARCVIVSVNYRLAP 137 >At5g06570.2 68418.m00742 expressed protein similar to PrMC3 [Pinus radiata] GI:5487873 Length = 329 Score = 37.5 bits (83), Expect = 0.009 Identities = 20/62 (32%), Positives = 34/62 (54%), Gaps = 3/62 (4%) Frame = +1 Query: 49 LHLNVYVPPSATSKNPVPVMVYIYGGSFRHGDFG---RHVYGPKFLVKHDVILVTLNYRL 219 LHL +Y P SA+++ +PV+V+ +GG F G H + + ++V+ +YRL Sbjct: 60 LHLRLYKPISASNRTALPVVVFFHGGGFCFGSRSWPHFHNFCLTLASSLNALVVSPDYRL 119 Query: 220 GP 225 P Sbjct: 120 AP 121 >At5g06570.1 68418.m00741 expressed protein similar to PrMC3 [Pinus radiata] GI:5487873 Length = 329 Score = 37.5 bits (83), Expect = 0.009 Identities = 20/62 (32%), Positives = 34/62 (54%), Gaps = 3/62 (4%) Frame = +1 Query: 49 LHLNVYVPPSATSKNPVPVMVYIYGGSFRHGDFG---RHVYGPKFLVKHDVILVTLNYRL 219 LHL +Y P SA+++ +PV+V+ +GG F G H + + ++V+ +YRL Sbjct: 60 LHLRLYKPISASNRTALPVVVFFHGGGFCFGSRSWPHFHNFCLTLASSLNALVVSPDYRL 119 Query: 220 GP 225 P Sbjct: 120 AP 121 >At1g47480.1 68414.m05267 expressed protein similar to PrMC3 [Pinus radiata] GI:5487873 Length = 314 Score = 34.7 bits (76), Expect = 0.061 Identities = 20/62 (32%), Positives = 31/62 (50%), Gaps = 3/62 (4%) Frame = +1 Query: 49 LHLNVYVPPSATSKNPVPVMVYIYGGSFRHGDF---GRHVYGPKFLVKHDVILVTLNYRL 219 L +Y P S +P+M+Y +GG+F H K + + +VI V++NYRL Sbjct: 56 LSARIYRPFSIQPGQKIPLMLYFHGGAFLISSTSFPSYHTSLNKIVNQANVIAVSVNYRL 115 Query: 220 GP 225 P Sbjct: 116 AP 117 >At1g68620.1 68414.m07841 expressed protein similar to PrMC3 [Pinus radiata] GI:5487873 Length = 336 Score = 32.7 bits (71), Expect = 0.25 Identities = 18/60 (30%), Positives = 33/60 (55%), Gaps = 5/60 (8%) Frame = +1 Query: 61 VYVPPSAT--SKNPVPVMVYIYGGSFRHGDFG---RHVYGPKFLVKHDVILVTLNYRLGP 225 +YVP + T S + +P++VY +GG F G H + + + +++++NYRL P Sbjct: 75 LYVPMTTTKSSVSKLPLIVYFHGGGFCVGSASWLCYHEFLARLSARSRCLVMSVNYRLAP 134 >At1g26120.1 68414.m03188 esterase-related contains similaity to esterase 6 GI:606998 from [Drosophila simulans] and esterase GI:12584120 from [Sphingomonas elodea] Length = 476 Score = 32.7 bits (71), Expect = 0.25 Identities = 14/33 (42%), Positives = 21/33 (63%) Frame = +3 Query: 276 KDQLLALKWVKEHIHNFGGDSNKITVSGESAGA 374 KD + +V HI +GGD ++I + G+SAGA Sbjct: 257 KDASSGISFVCNHIAEYGGDPDRIYLMGQSAGA 289 >At3g63010.1 68416.m07078 expressed protein similar to PrMC3 [Pinus radiata] GI:5487873 Length = 358 Score = 32.3 bits (70), Expect = 0.32 Identities = 14/46 (30%), Positives = 26/46 (56%), Gaps = 3/46 (6%) Frame = +1 Query: 97 VPVMVYIYGGSFRHGDFGRHVYGP---KFLVKHDVILVTLNYRLGP 225 VPV+++ +GGSF H +Y + + V++V+++YR P Sbjct: 106 VPVLIFFHGGSFTHSSANSAIYDTFCRRLVTICGVVVVSVDYRRSP 151 >At3g02410.1 68416.m00228 hypothetical protein weak similarity to kynurenine formamidase [Mus musculus] GI:21552719 Length = 422 Score = 32.3 bits (70), Expect = 0.32 Identities = 20/59 (33%), Positives = 32/59 (54%) Frame = +1 Query: 55 LNVYVPPSATSKNPVPVMVYIYGGSFRHGDFGRHVYGPKFLVKHDVILVTLNYRLGPYG 231 L++Y+PP TS PV+V++ GG++ G L + D+I+ L+YR P G Sbjct: 138 LDLYIPP--TSDGLKPVVVFVTGGAWIIGYKAWGSLLGLQLAERDIIVACLDYRNFPQG 194 Score = 31.1 bits (67), Expect = 0.75 Identities = 14/32 (43%), Positives = 20/32 (62%) Frame = +3 Query: 279 DQLLALKWVKEHIHNFGGDSNKITVSGESAGA 374 D + +V +I FGGD N+I + G+SAGA Sbjct: 202 DAAQGISFVCNNISAFGGDPNRIYLMGQSAGA 233 >At5g27320.1 68418.m03262 expressed protein similar to PrMC3 [Pinus radiata] GI:5487873 Length = 344 Score = 31.9 bits (69), Expect = 0.43 Identities = 15/46 (32%), Positives = 25/46 (54%), Gaps = 3/46 (6%) Frame = +1 Query: 97 VPVMVYIYGGSFRHGDFGRHVYGP---KFLVKHDVILVTLNYRLGP 225 VPV+V+ +GGSF H +Y + + ++V++NYR P Sbjct: 104 VPVIVFFHGGSFAHSSANSAIYDTLCRRLVGLCGAVVVSVNYRRAP 149 >At2g03550.1 68415.m00315 expressed protein similar to PrMC3 [Pinus radiata] GI:5487873; contains an esterase/lipase/thioesterase active site serine domain (prosite: PS50187) Length = 312 Score = 31.5 bits (68), Expect = 0.57 Identities = 17/62 (27%), Positives = 31/62 (50%), Gaps = 3/62 (4%) Frame = +1 Query: 49 LHLNVYVPPSATSKNPVPVMVYIYGGSF-RHGDFG--RHVYGPKFLVKHDVILVTLNYRL 219 L L +Y+P T K +P+++Y +GG F F H + + + + +++NYR Sbjct: 53 LSLRIYLPEKVTVKK-LPILIYFHGGGFIIETAFSPPYHTFLTSAVAAANCLAISVNYRR 111 Query: 220 GP 225 P Sbjct: 112 AP 113 Score = 29.5 bits (63), Expect = 2.3 Identities = 22/74 (29%), Positives = 36/74 (48%), Gaps = 9/74 (12%) Frame = +3 Query: 273 FKDQLLALKWVKEHIHNFG--------GDSNKITVSGESAGAIAVDFHL-MYNKEKLFHK 425 ++D +LKWV HI G GD K+ ++G+SAG + HL M K++ Sbjct: 121 YEDSWDSLKWVLTHITGTGPETWINKHGDFGKVFLAGDSAGG-NISHHLTMRAKKEKLCD 179 Query: 426 AIIQSGTTLSPVFY 467 ++I + P F+ Sbjct: 180 SLISGIILIHPYFW 193 >At3g48700.1 68416.m05318 expressed protein similar to PrMC3 [Pinus radiata] GI:5487873 Length = 329 Score = 31.1 bits (67), Expect = 0.75 Identities = 22/66 (33%), Positives = 34/66 (51%), Gaps = 9/66 (13%) Frame = +3 Query: 273 FKDQLLALKWVKEHIHNFG--------GDSNKITVSGESAGA-IAVDFHLMYNKEKLFHK 425 + D ALKWV HI G D +K+ ++G+SAGA I + K+KL + Sbjct: 127 YDDSWTALKWVFSHIAGSGSEDWLNKHADFSKVFLAGDSAGANITHHMTMKAAKDKLSPE 186 Query: 426 AIIQSG 443 ++ +SG Sbjct: 187 SLNESG 192 >At5g15860.2 68418.m01856 expressed protein Length = 299 Score = 30.7 bits (66), Expect = 0.99 Identities = 14/32 (43%), Positives = 20/32 (62%) Frame = +3 Query: 279 DQLLALKWVKEHIHNFGGDSNKITVSGESAGA 374 D + +V +I FGGD N+I + G+SAGA Sbjct: 207 DASQGISFVCNNISAFGGDPNRIYLMGQSAGA 238 >At5g15860.1 68418.m01855 expressed protein Length = 427 Score = 30.7 bits (66), Expect = 0.99 Identities = 14/32 (43%), Positives = 20/32 (62%) Frame = +3 Query: 279 DQLLALKWVKEHIHNFGGDSNKITVSGESAGA 374 D + +V +I FGGD N+I + G+SAGA Sbjct: 207 DASQGISFVCNNISAFGGDPNRIYLMGQSAGA 238 >At1g19190.1 68414.m02389 expressed protein contains similarity to anther-specific and pathogenesis response protein (PrMC3) GI:5487873 from [Pinus radiata] Length = 318 Score = 30.7 bits (66), Expect = 0.99 Identities = 19/65 (29%), Positives = 32/65 (49%), Gaps = 6/65 (9%) Frame = +1 Query: 49 LHLNVYVPPSA---TSKNPVPVMVYIYGGSF-RHGDFG--RHVYGPKFLVKHDVILVTLN 210 L L +Y+P ++ T + +P++VY +GG F F H + + D I V++ Sbjct: 53 LSLRIYLPQNSVYETGEKKIPLLVYFHGGGFIMETAFSPIYHTFLTSAVSATDCIAVSVE 112 Query: 211 YRLGP 225 YR P Sbjct: 113 YRRAP 117 >At3g05120.1 68416.m00556 expressed protein low similarity to PrMC3 [Pinus radiata] GI:5487873 Length = 345 Score = 30.3 bits (65), Expect = 1.3 Identities = 14/46 (30%), Positives = 25/46 (54%), Gaps = 3/46 (6%) Frame = +1 Query: 97 VPVMVYIYGGSFRHGDFGRHVYGP---KFLVKHDVILVTLNYRLGP 225 VPV+++ +GGSF H +Y + + ++V++NYR P Sbjct: 106 VPVILFFHGGSFAHSSANSAIYDTLCRRLVGLCKCVVVSVNYRRAP 151 >At3g48690.1 68416.m05317 expressed protein similar to PrMC3 [Pinus radiata] GI:5487873 Length = 324 Score = 29.9 bits (64), Expect = 1.7 Identities = 23/57 (40%), Positives = 28/57 (49%), Gaps = 9/57 (15%) Frame = +3 Query: 273 FKDQLLALKWVKEHIHNFG--------GDSNKITVSGESAGAIAVDFHLM-YNKEKL 416 F D ALKWV HI G D +++ +SG+SAGA V M KEKL Sbjct: 124 FDDSWTALKWVFTHITGSGQEDWLNKHADFSRVFLSGDSAGANIVHHMAMRAAKEKL 180 >At1g49640.1 68414.m05567 hypothetical protein similar to PrMC3 [Pinus radiata] GI:5487873 Length = 315 Score = 29.9 bits (64), Expect = 1.7 Identities = 14/51 (27%), Positives = 29/51 (56%), Gaps = 3/51 (5%) Frame = +1 Query: 82 TSKNPVPVMVYIYGGSF-RHGDFG--RHVYGPKFLVKHDVILVTLNYRLGP 225 T+ N +P+++Y +GG++ F H Y + ++ + + V++ YRL P Sbjct: 69 TAGNKIPLLIYFHGGAYIIQSPFSPVYHNYLTEVVITANCLAVSVQYRLAP 119 >At5g23530.1 68418.m02761 expressed protein contains similarity to PrMC3 [Pinus radiata] GI:5487873 Length = 335 Score = 29.5 bits (63), Expect = 2.3 Identities = 18/62 (29%), Positives = 30/62 (48%), Gaps = 3/62 (4%) Frame = +1 Query: 49 LHLNVYVPPSATSKNPVPVMVYIYGGSFRHGDFGRHVYG---PKFLVKHDVILVTLNYRL 219 L +Y P + K +PV+V+ +GG F + Y +F K ++++NYRL Sbjct: 73 LWFRLYTPHVSGDK--IPVVVFFHGGGFAFLSPNAYPYDNVCRRFARKLPAYVISVNYRL 130 Query: 220 GP 225 P Sbjct: 131 AP 132 >At5g14310.1 68418.m01673 expressed protein low similarity to PrMC3 [Pinus radiata] GI:5487873 Length = 446 Score = 29.5 bits (63), Expect = 2.3 Identities = 17/57 (29%), Positives = 30/57 (52%), Gaps = 3/57 (5%) Frame = +1 Query: 64 YVPPSATSKNPVPVMVYIYGGSFRHG--DFGRHVYGPKFLVK-HDVILVTLNYRLGP 225 Y P + + +PVM+ +GG + G D + + + + K DVI++ + YRL P Sbjct: 140 YAPSAKRNSRKLPVMLQFHGGGWVSGSSDSAANDFFCRRIAKVCDVIVLAVGYRLAP 196 >At3g14960.1 68416.m01892 galactosyltransferase family protein contains Pfam profile: PF01762 galactosyltransferase Length = 343 Score = 29.5 bits (63), Expect = 2.3 Identities = 27/92 (29%), Positives = 36/92 (39%), Gaps = 3/92 (3%) Frame = +1 Query: 1 LKLTKPLAYYIGTIDCLHLNVYVPPSATSKNPVPVMVYIYGGSFRHGDFGRHVYGPKFL- 177 LK +PLA +G LH Y P A S + V +V + SFR G L Sbjct: 227 LKWYEPLADLLGKEYFLH--AYGPIYALSADVVTSLVALKNNSFRMFSNEDVTIGAWMLA 284 Query: 178 --VKHDVILVTLNYRLGPYGFMCLDIPECRAI 267 V H+ + PY DIP+C + Sbjct: 285 MNVNHENLHTLCEPECSPYSIAVWDIPKCSGL 316 >At2g45600.1 68415.m05670 expressed protein low similarity to PrMC3 [Pinus radiata] GI:5487873 Length = 329 Score = 28.7 bits (61), Expect = 4.0 Identities = 14/60 (23%), Positives = 29/60 (48%), Gaps = 3/60 (5%) Frame = +1 Query: 55 LNVYVPPSATSKNPVPVMVYIYGGSF---RHGDFGRHVYGPKFLVKHDVILVTLNYRLGP 225 + ++ P + ++ +P++VY +GG F H K + I++++ YRL P Sbjct: 52 IRIFKPRNIPPESKLPILVYFHGGGFILYSAASAPFHESCTKMADRLQTIILSVEYRLAP 111 >At2g41530.1 68415.m05132 esterase, putative similar to SP|P10768 Esterase D (EC 3.1.1.1) {Homo sapiens}; contains Pfam profile: PF00756 putative esterase Length = 284 Score = 28.7 bits (61), Expect = 4.0 Identities = 12/38 (31%), Positives = 23/38 (60%), Gaps = 1/38 (2%) Frame = +1 Query: 13 KPLAYYIGTIDC-LHLNVYVPPSATSKNPVPVMVYIYG 123 K ++ T+ C + ++Y PPSA+S + PV+ ++ G Sbjct: 19 KRYKHFSETLGCSMTFSIYFPPSASSSHKSPVLYWLSG 56 >At3g05690.1 68416.m00636 CCAAT-binding transcription factor (CBF-B/NF-YA) family protein contains Pfam profile: PF02045 CCAAT-binding transcription factor (CBF-B/NF-YA) subunit B Length = 295 Score = 28.3 bits (60), Expect = 5.3 Identities = 12/40 (30%), Positives = 25/40 (62%) Frame = -1 Query: 225 RPKPVIQRDQNNVVLYQEFGTIDVSSEIAMSETAPVDVNH 106 +PKP QN+ V++ E GT+++S+ + +S + +N+ Sbjct: 222 QPKPQQSNSQNSEVVHPENGTMNLSNGLNVSGSEVTSMNY 261 >At5g61990.1 68418.m07780 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile PF01535: PPR repeat Length = 974 Score = 27.9 bits (59), Expect = 7.0 Identities = 18/59 (30%), Positives = 28/59 (47%), Gaps = 4/59 (6%) Frame = +2 Query: 521 DDLNAAIAFLAQVDPSLVIAAVFD----LGIELNVRPCVEKSFEGVERFVDQNWITADV 685 DD + ++F VD V D L ++L EK+ VER +++NW A+V Sbjct: 75 DDPSKLLSFFNWVDSQKVTEQKLDSFSFLALDLCNFGSFEKALSVVERMIERNWPVAEV 133 >At4g29490.1 68417.m04208 Xaa-Pro dipeptidase, putative / prolidase, putative / imidodipeptidase, putative similar to SP|P12955 Xaa-Pro dipeptidase (EC 3.4.13.9) (X-Pro dipeptidase) (Proline dipeptidase) (Prolidase) (Imidodipeptidase) {Homo sapiens}; contains Pfam profiles PF00557: metallopeptidase family M24, PF05195: Aminopeptidase P, N-terminal domain Length = 333 Score = 27.9 bits (59), Expect = 7.0 Identities = 20/58 (34%), Positives = 26/58 (44%) Frame = +3 Query: 243 GHP*VPGNQGFKDQLLALKWVKEHIHNFGGDSNKITVSGESAGAIAVDFHLMYNKEKL 416 GH P ++ F+D LAL + H +G D IT S G D L+YN L Sbjct: 255 GHAAAPNDRTFEDGDLALLDMGAEYHFYGSD---ITCSFPVNGKFTSDQSLIYNVSAL 309 >At4g23760.1 68417.m03418 expressed protein Length = 187 Score = 27.9 bits (59), Expect = 7.0 Identities = 17/59 (28%), Positives = 27/59 (45%) Frame = -1 Query: 612 TFNSMPKSKTAAMTKLGSTWAKKAMAAFKSSVMYPVFRLSKLVRFSKARKRLATVLSRS 436 TFN + T + T + +F+S M P+F +S+ +R K K + SRS Sbjct: 127 TFNGETEYSTNLRPRGSPTSQLRRGVSFRSREMRPIFAISQRMRSIKESKEVLDTESRS 185 >At2g06025.1 68415.m00659 GCN5-related N-acetyltransferase (GNAT) family protein low similarity to streptothricin acetyltransferase homolog [Campylobacter jejuni] GI:6650363; contains Pfam profile PF00583: acetyltransferase, GNAT family Length = 288 Score = 27.9 bits (59), Expect = 7.0 Identities = 10/17 (58%), Positives = 11/17 (64%) Frame = +1 Query: 547 LSPSRPQFGHSCRFRFG 597 L P P+FGH RF FG Sbjct: 73 LQPPEPEFGHEDRFEFG 89 >At4g18250.1 68417.m02710 receptor serine/threonine kinase, putative similar to to receptor serine/threonine kinase PR5K gi|1235680|gb|AAC49208 Length = 853 Score = 27.5 bits (58), Expect = 9.2 Identities = 9/28 (32%), Positives = 16/28 (57%) Frame = -2 Query: 515 CTQFFGYQNWCVSRRLVKDWRQCCPALY 432 CT +F Y+ C V+++ + CP+ Y Sbjct: 384 CTNYFKYKQTCKPTPYVQNFDRACPSAY 411 >At4g04930.1 68417.m00717 fatty acid desaturase family protein similar to D. melanogaster Des-1 protein, GenBank accession number X94180; contains Pfam profile PF00487 Fatty acid desaturase domain Length = 332 Score = 27.5 bits (58), Expect = 9.2 Identities = 11/28 (39%), Positives = 17/28 (60%), Gaps = 2/28 (7%) Frame = +3 Query: 192 YFGHVELQAWAVRFHVSGH--P*VPGNQ 269 Y+G + L W+V +H H P +PGN+ Sbjct: 257 YYGPLNLLTWSVGYHNEHHDFPRIPGNK 284 >At2g45470.1 68415.m05655 fasciclin-like arabinogalactan-protein (FLA8) Length = 420 Score = 27.5 bits (58), Expect = 9.2 Identities = 15/30 (50%), Positives = 19/30 (63%) Frame = +3 Query: 399 YNKEKLFHKAIIQSGTTLSPVFYEPSRNAP 488 Y+ +KL HK I GTTLS Y+ + NAP Sbjct: 95 YDPQKL-HK--ISKGTTLSTTLYQTTGNAP 121 >At1g78950.1 68414.m09204 beta-amyrin synthase, putative similar to beta-Amyrin Synthase GI:3688600 from [Panax ginseng] and GI:8918271 from [Pisum sativum] Length = 759 Score = 27.5 bits (58), Expect = 9.2 Identities = 13/50 (26%), Positives = 25/50 (50%) Frame = +1 Query: 16 PLAYYIGTIDCLHLNVYVPPSATSKNPVPVMVYIYGGSFRHGDFGRHVYG 165 PL + + CL++ ++ TS++ ++ YIY G +G H+ G Sbjct: 123 PLFFLPPLVFCLYITGHLDEVFTSEHRKEILRYIYCHQKEDGGWGLHIEG 172 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,535,287 Number of Sequences: 28952 Number of extensions: 369972 Number of successful extensions: 1008 Number of sequences better than 10.0: 31 Number of HSP's better than 10.0 without gapping: 970 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1008 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1526202912 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -