BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0782 (764 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_7282| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_1374| Best HMM Match : PAN (HMM E-Value=0.013) 29 4.1 >SB_7282| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1702 Score = 30.3 bits (65), Expect = 1.8 Identities = 19/42 (45%), Positives = 24/42 (57%), Gaps = 4/42 (9%) Frame = -1 Query: 590 NITENT*IIYFAIN----DTFNCNAVNTVQFIIYKTMTIILM 477 NI NT IIY IN +T N +NT+ II T TII++ Sbjct: 1395 NIIINTIIIYTTINTIIINTINTIIINTMNTIIVTTTTIIII 1436 >SB_1374| Best HMM Match : PAN (HMM E-Value=0.013) Length = 498 Score = 29.1 bits (62), Expect = 4.1 Identities = 14/45 (31%), Positives = 22/45 (48%) Frame = +1 Query: 532 LQLNVSLIAK*MIHVFSVILFNDEKMSLSKISHNTVCFAINDTFV 666 + +NV AK H S I+ + L + HN F++N TF+ Sbjct: 152 ITVNVKSYAKGSFHGLSEIIVDGTDYCLKQRGHNFAAFSMNGTFI 196 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,420,377 Number of Sequences: 59808 Number of extensions: 320325 Number of successful extensions: 649 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 583 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 647 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2072022557 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -