BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0780 (779 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY887136-1|AAW78361.1| 580|Tribolium castaneum vasa RNA helicas... 24 1.6 AM295015-1|CAL25730.1| 549|Tribolium castaneum ecdysone recepto... 22 6.3 DQ855504-1|ABH88191.1| 124|Tribolium castaneum chemosensory pro... 21 8.4 AM292371-1|CAL23183.2| 350|Tribolium castaneum gustatory recept... 21 8.4 >AY887136-1|AAW78361.1| 580|Tribolium castaneum vasa RNA helicase protein. Length = 580 Score = 23.8 bits (49), Expect = 1.6 Identities = 10/22 (45%), Positives = 15/22 (68%) Frame = +3 Query: 369 IPYFTTSGIQVRYLKIIEKSGY 434 I F TSG++ L+ ++KSGY Sbjct: 157 ITSFETSGLRPHLLENVKKSGY 178 >AM295015-1|CAL25730.1| 549|Tribolium castaneum ecdysone receptor (isoform A) protein. Length = 549 Score = 21.8 bits (44), Expect = 6.3 Identities = 14/52 (26%), Positives = 22/52 (42%) Frame = +1 Query: 118 KSQFKRRSTANNVEIIIPVPADADSPKFKTTIGSVKYTPEQNAITCQSNHFQ 273 K + K ST N +I V + + GS +PEQ + + +FQ Sbjct: 275 KEKDKPNSTTNGSPDVIKVEPELSDSEKTLCNGSKGISPEQEELIHRLVYFQ 326 >DQ855504-1|ABH88191.1| 124|Tribolium castaneum chemosensory protein 18 protein. Length = 124 Score = 21.4 bits (43), Expect = 8.4 Identities = 9/33 (27%), Positives = 17/33 (51%) Frame = +3 Query: 333 VDGKPPIQVKFEIPYFTTSGIQVRYLKIIEKSG 431 +D KP + + E Y + + +Y +EK+G Sbjct: 89 IDNKPDMWKQLEAKYDPSGEYRSKYKDELEKNG 121 >AM292371-1|CAL23183.2| 350|Tribolium castaneum gustatory receptor candidate 50 protein. Length = 350 Score = 21.4 bits (43), Expect = 8.4 Identities = 11/27 (40%), Positives = 15/27 (55%) Frame = -3 Query: 471 HSE*CTLPKVGLGIHFFQ*FSDILLEF 391 H+E C L +V I+ FQ F +L F Sbjct: 218 HNELCNLCQVANSIYGFQNFLFVLSTF 244 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 167,844 Number of Sequences: 336 Number of extensions: 3383 Number of successful extensions: 6 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 21065107 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -