BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0771 (502 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z66515-4|CAA91350.1| 153|Caenorhabditis elegans Hypothetical pr... 61 4e-10 Z69787-1|CAA93642.1| 300|Caenorhabditis elegans Hypothetical pr... 27 5.8 >Z66515-4|CAA91350.1| 153|Caenorhabditis elegans Hypothetical protein R53.4 protein. Length = 153 Score = 61.3 bits (142), Expect = 4e-10 Identities = 27/55 (49%), Positives = 34/55 (61%) Frame = +2 Query: 92 GDYPKEYNPAVHGPYDPARYYGKPDTPFSQLKLNEIGSWFGRRSKTPSAVAGAFI 256 G + K +N VHGPY RYYGK DT F +KL ++ +W RR KTPSA F+ Sbjct: 47 GLFDKRWNKNVHGPYCHWRYYGKLDTKFMDVKLGDLPAWMARREKTPSAFYNEFM 101 >Z69787-1|CAA93642.1| 300|Caenorhabditis elegans Hypothetical protein C44C10.1 protein. Length = 300 Score = 27.5 bits (58), Expect = 5.8 Identities = 19/54 (35%), Positives = 23/54 (42%) Frame = +2 Query: 116 PAVHGPYDPARYYGKPDTPFSQLKLNEIGSWFGRRSKTPSAVAGAFIEPGGDGN 277 P GP PA G P P SQ +G + AGA +PGG+GN Sbjct: 231 PGPDGPAGPAGSPGAPGNPGSQGSQGPVGD---------NGAAGAPGQPGGNGN 275 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,419,995 Number of Sequences: 27780 Number of extensions: 240377 Number of successful extensions: 580 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 562 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 579 length of database: 12,740,198 effective HSP length: 76 effective length of database: 10,628,918 effective search space used: 956602620 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -