BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0769 (531 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF281078-1|AAF82131.1| 2051|Anopheles gambiae vitellogenin 1 pro... 24 3.7 CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskel... 23 4.8 AJ441131-8|CAD29637.1| 756|Anopheles gambiae putative 5-oxoprol... 23 4.8 AJ439398-7|CAD28130.1| 1344|Anopheles gambiae putative 5-oxoprol... 23 4.8 AF313909-1|AAL99382.1| 1024|Anopheles gambiae collagen IV alpha ... 23 4.8 >AF281078-1|AAF82131.1| 2051|Anopheles gambiae vitellogenin 1 protein. Length = 2051 Score = 23.8 bits (49), Expect = 3.7 Identities = 10/27 (37%), Positives = 13/27 (48%) Frame = -3 Query: 469 FLNLKPLSHKQMHMCFTGGQMRFSVPK 389 F P S KQ MCF+ ++PK Sbjct: 1441 FFEFIPFSGKQFQMCFSATNQYPNMPK 1467 >CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskeletal structural protein protein. Length = 1645 Score = 23.4 bits (48), Expect = 4.8 Identities = 13/38 (34%), Positives = 16/38 (42%) Frame = -1 Query: 270 PGSDGLTRLPAGAVYLTLTACELAVAARVTTKLRNSLS 157 PG+DG P G +T L V A T L + S Sbjct: 1511 PGTDGAAAAPTGGAAVTNATSILQVYAAYETGLPSGTS 1548 >AJ441131-8|CAD29637.1| 756|Anopheles gambiae putative 5-oxoprolinase protein. Length = 756 Score = 23.4 bits (48), Expect = 4.8 Identities = 13/39 (33%), Positives = 18/39 (46%) Frame = +3 Query: 246 DASGRPSPGSRGVPVRDCPPCRGRGRFNFRHSPVQKLST 362 + SG+ PG PV DC R R + + +LST Sbjct: 645 EGSGQAPPGRLVTPVYDCAKLRYGHRVDGPAILIDRLST 683 >AJ439398-7|CAD28130.1| 1344|Anopheles gambiae putative 5-oxoprolinase protein. Length = 1344 Score = 23.4 bits (48), Expect = 4.8 Identities = 13/39 (33%), Positives = 18/39 (46%) Frame = +3 Query: 246 DASGRPSPGSRGVPVRDCPPCRGRGRFNFRHSPVQKLST 362 + SG+ PG PV DC R R + + +LST Sbjct: 689 EGSGQAPPGRLVTPVYDCAKLRYGHRVDGPAILIDRLST 727 >AF313909-1|AAL99382.1| 1024|Anopheles gambiae collagen IV alpha 1 chain protein. Length = 1024 Score = 23.4 bits (48), Expect = 4.8 Identities = 12/26 (46%), Positives = 14/26 (53%), Gaps = 1/26 (3%) Frame = -3 Query: 328 LNRPRPRQGGQSRTGTPLLPG-LGRP 254 L P+ +GG G P LPG LG P Sbjct: 114 LRGPKGERGGMGDRGDPGLPGSLGYP 139 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 508,280 Number of Sequences: 2352 Number of extensions: 10017 Number of successful extensions: 28 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 24 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 28 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 49051644 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -