BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0769 (531 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U29096-4|AAA68408.1| 1599|Caenorhabditis elegans Hypothetical pr... 29 1.6 Z71258-1|CAA95780.1| 307|Caenorhabditis elegans Hypothetical pr... 27 8.4 U20864-6|AAK68356.1| 1000|Caenorhabditis elegans Hypothetical pr... 27 8.4 >U29096-4|AAA68408.1| 1599|Caenorhabditis elegans Hypothetical protein F30H5.3 protein. Length = 1599 Score = 29.5 bits (63), Expect = 1.6 Identities = 11/32 (34%), Positives = 18/32 (56%) Frame = +3 Query: 339 SPVQKLSTKRISLQCTDLGTLNLICPPVKHIC 434 S Q S+ + +CT +G++ L CP V +C Sbjct: 415 SNCQTASSCTSNFECTSIGSMQLCCPTVASVC 446 >Z71258-1|CAA95780.1| 307|Caenorhabditis elegans Hypothetical protein C01H6.1 protein. Length = 307 Score = 27.1 bits (57), Expect = 8.4 Identities = 12/33 (36%), Positives = 18/33 (54%) Frame = +3 Query: 198 QPARRLST*GTRRPPVDASGRPSPGSRGVPVRD 296 +P + + G PP ++ +PGSRGVP D Sbjct: 97 EPTKPVCPPGPPGPPGNSGSPGNPGSRGVPGED 129 >U20864-6|AAK68356.1| 1000|Caenorhabditis elegans Hypothetical protein F32A5.2a protein. Length = 1000 Score = 27.1 bits (57), Expect = 8.4 Identities = 20/54 (37%), Positives = 27/54 (50%), Gaps = 3/54 (5%) Frame = +3 Query: 195 RQPARRLST*GTRRPPVDASGRPS-PGSRGVPVRDCPP--CRGRGRFNFRHSPV 347 R P R+L+ T RPPV + RP+ P SR PV P + + HSP+ Sbjct: 93 RPPPRKLAQ--TPRPPVVTTQRPAPPQSRPPPVTRRPTFISTTTSKLSTTHSPI 144 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,135,218 Number of Sequences: 27780 Number of extensions: 226131 Number of successful extensions: 800 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 684 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 797 length of database: 12,740,198 effective HSP length: 77 effective length of database: 10,601,138 effective search space used: 1049512662 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -