BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0768 (652 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g18810.1 68416.m02389 protein kinase family protein contains ... 33 0.22 At3g28790.1 68416.m03593 expressed protein 32 0.29 At2g35350.1 68415.m04334 protein phosphatase 2C family protein /... 32 0.29 At4g39380.1 68417.m05574 expressed protein 31 0.88 At1g70740.1 68414.m08154 protein kinase family protein contains ... 31 0.88 At5g62940.1 68418.m07897 Dof-type zinc finger domain-containing ... 29 2.0 At4g34300.1 68417.m04875 glycine-rich protein similar to auxin r... 29 2.0 At2g28670.1 68415.m03485 disease resistance-responsive family pr... 29 2.7 At5g50920.1 68418.m06315 ATP-dependent Clp protease ATP-binding ... 29 3.5 At3g44340.1 68416.m04764 sec23/sec24 transport family protein co... 29 3.5 At3g29080.1 68416.m03641 hypothetical protein 29 3.5 At2g43010.2 68415.m05338 phytochrome-interacting factor 4 (PIF4)... 29 3.5 At2g43010.1 68415.m05337 phytochrome-interacting factor 4 (PIF4)... 29 3.5 At4g37130.1 68417.m05258 hydroxyproline-rich glycoprotein family... 28 4.7 At3g48870.1 68416.m05338 ATP-dependent Clp protease ATP-binding ... 28 6.2 At4g22290.1 68417.m03224 ubiquitin carboxyl-terminal hydrolase f... 27 8.2 >At3g18810.1 68416.m02389 protein kinase family protein contains Pfam PF00069: Protein kinase domain Length = 700 Score = 32.7 bits (71), Expect = 0.22 Identities = 19/60 (31%), Positives = 32/60 (53%), Gaps = 1/60 (1%) Frame = -1 Query: 490 NGSNVSNLDRLGDGAIDNNHGLSNDFGFV-NDNHGLRDNGIDTGSGDNRGRASLVDVQND 314 N +N +N + G+ DNN+G + D N+N+G +NG D +N G + + QN+ Sbjct: 79 NNNNDNNNNNNGNNNNDNNNGNNKDNNNNGNNNNGNNNNGNDNNGNNNNGNNNDNNNQNN 138 >At3g28790.1 68416.m03593 expressed protein Length = 608 Score = 32.3 bits (70), Expect = 0.29 Identities = 34/135 (25%), Positives = 54/135 (40%), Gaps = 2/135 (1%) Frame = -1 Query: 466 DRLGDGAIDNNHGLSNDFGFVNDNHGLRDNGIDTGSGDNRGRASLVDVQNDLHERSAVSN 287 ++ G ++++GL D VN + G + S DN +S Q + + S Sbjct: 172 EKRGKSIDESSYGLDVD---VNASIGSSSGSDGSSSSDNES-SSNTKSQGTSSKSGSEST 227 Query: 286 GGKRRVVYDSGPTEIGTNSSTMAGPTEI--GSNSLTMAGPTEMGSNSSMMAGPTAIGTKS 113 G S TE G+ SS+ A E+ GS+ T T S +S PT + Sbjct: 228 AGSIETNTGS-KTEAGSKSSSSAKTKEVSGGSSGNTYKDTTGSSSGASPSGSPTPTPSTP 286 Query: 112 SMMGAGPATPGXTRP 68 + P+TP + P Sbjct: 287 TPSTPTPSTPTPSTP 301 >At2g35350.1 68415.m04334 protein phosphatase 2C family protein / PP2C family protein similar to protein phosphatase-2c (GI:3608412) [Mesembryanthemum crystallinum]; contains Pfam PF00481 : Protein phosphatase 2C domain Length = 783 Score = 32.3 bits (70), Expect = 0.29 Identities = 29/99 (29%), Positives = 47/99 (47%), Gaps = 2/99 (2%) Frame = -1 Query: 373 IDTGSGDNRGRASLVDVQNDLHERSAVSNGGKRRVVYDSGPTEIGTNSSTMAGPTEIGSN 194 + + +++ L D+ +D E S GG RR V ++ E GT SS A P + G + Sbjct: 107 VSANTSNSKTVLQLEDIYDDATESSF--GGGVRRSVVNANGFE-GT-SSFSALPLQPGPD 162 Query: 193 --SLTMAGPTEMGSNSSMMAGPTAIGTKSSMMGAGPATP 83 L M+GP E G+ S + P ++S+ G + P Sbjct: 163 RSGLFMSGPIERGATSGPLDPPAGEISRSNSAGVHFSAP 201 >At4g39380.1 68417.m05574 expressed protein Length = 518 Score = 30.7 bits (66), Expect = 0.88 Identities = 18/59 (30%), Positives = 31/59 (52%), Gaps = 2/59 (3%) Frame = -3 Query: 215 PNGDRFEFVDNGRSDGNGLELIY--DGRSDSDRYKVVDDGSRSGNAGXHQALSRAGDSN 45 P+ + E +N +DG+G L++ DG + ++ + S GN G H S AG++N Sbjct: 238 PHDGQVESTENKINDGSGPTLLFWDDGLTSLSIGGLLSEVSLKGNFGNHCKNSNAGNAN 296 >At1g70740.1 68414.m08154 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 425 Score = 30.7 bits (66), Expect = 0.88 Identities = 18/57 (31%), Positives = 27/57 (47%) Frame = -1 Query: 280 KRRVVYDSGPTEIGTNSSTMAGPTEIGSNSLTMAGPTEMGSNSSMMAGPTAIGTKSS 110 +RR SG +GT S+T + GSN T G G+ +S A + T+S+ Sbjct: 353 RRRTQRPSGAASLGTLSTTGSSTDSFGSNLNTNTGTGVRGTPASSKASTRSNATRSA 409 >At5g62940.1 68418.m07897 Dof-type zinc finger domain-containing protein Dof zinc finger protein, Oryza sativa, EMBL:AB028129 Length = 372 Score = 29.5 bits (63), Expect = 2.0 Identities = 22/63 (34%), Positives = 31/63 (49%), Gaps = 4/63 (6%) Frame = -1 Query: 499 LGSNGSNVS--NLDRLGDGAIDNNH--GLSNDFGFVNDNHGLRDNGIDTGSGDNRGRASL 332 +G N N+ N GD +NH GL++ G N+N+ NGI TG N G L Sbjct: 217 MGVNNDNLVMVNHGSNGDHHHHHNHHMGLNHGVGLNNNNNNGGFNGISTGGNGNGG--GL 274 Query: 331 VDV 323 +D+ Sbjct: 275 MDI 277 >At4g34300.1 68417.m04875 glycine-rich protein similar to auxin response factor 30 (GI:20145855) {Arabidopsis thaliana} Length = 313 Score = 29.5 bits (63), Expect = 2.0 Identities = 36/132 (27%), Positives = 55/132 (41%) Frame = -1 Query: 502 WLGSNGSNVSNLDRLGDGAIDNNHGLSNDFGFVNDNHGLRDNGIDTGSGDNRGRASLVDV 323 W S+GSN S+ G G+ N H ++ + G NG +GS + S + Sbjct: 81 WGSSSGSNHSS----GTGSTHNGHSSGSNH---SSGTGSTHNGHSSGSNHSSSTGSTHNN 133 Query: 322 QNDLHERSAVSNGGKRRVVYDSGPTEIGTNSSTMAGPTEIGSNSLTMAGPTEMGSNSSMM 143 + S++ G + SG +N S++AGPT G +S GSN S + Sbjct: 134 HSSGSNHSSIV--GSTHKNHGSG-----SNHSSIAGPTHNGHSS---------GSNHSSI 177 Query: 142 AGPTAIGTKSSM 107 G T T S+ Sbjct: 178 IGSTHNHTAPSL 189 >At2g28670.1 68415.m03485 disease resistance-responsive family protein / fibroin-related contains similarity to silk fibroin heavy chain [Bombyx mori] gi|765323|gb|AAB31861; contains disease resistance response protien domain Pfam:FP03018 Length = 447 Score = 29.1 bits (62), Expect = 2.7 Identities = 22/63 (34%), Positives = 26/63 (41%), Gaps = 3/63 (4%) Frame = -1 Query: 259 SGPTEIGTNSSTMAGPTEIGSNSLTMAGPTE---MGSNSSMMAGPTAIGTKSSMMGAGPA 89 SGP + T SS GS SL G G+ S++ GP A GAGPA Sbjct: 93 SGPGLLPTASSVPGSLAGGGSGSLPTTGSATGAGAGTGSALGGGPGAGSALGGGAGAGPA 152 Query: 88 TPG 80 G Sbjct: 153 LGG 155 >At5g50920.1 68418.m06315 ATP-dependent Clp protease ATP-binding subunit / ClpC almost identical to ClpC GI:2921158 from [Arabidopsis thaliana]; contains Pfam profile PF02861: Clp amino terminal domain; contains Pfam profile PF00004: ATPase, AAA family; contains Pfam profile PF02151: UvrB/uvrC motif Length = 929 Score = 28.7 bits (61), Expect = 3.5 Identities = 14/42 (33%), Positives = 21/42 (50%), Gaps = 1/42 (2%) Frame = +3 Query: 132 VGPAIIDEFEP-ISVGPAIVNEFEPISVGPAIVDEFVPISVG 254 +G +DE+ I PA+ F+P+ V VDE + I G Sbjct: 406 IGATTLDEYRKHIEKDPALERRFQPVKVPEPTVDETIQILKG 447 >At3g44340.1 68416.m04764 sec23/sec24 transport family protein contains Pfam domains PF04811: Sec23/Sec24 trunk domain, PF04815: Sec23/Sec24 helical domain and PF04810: Sec23/Sec24 zinc finger Length = 1096 Score = 28.7 bits (61), Expect = 3.5 Identities = 23/70 (32%), Positives = 28/70 (40%), Gaps = 2/70 (2%) Frame = -1 Query: 259 SGPTEIGTNSSTMAGP-TEIGSNSLTMAGPTEMGSN-SSMMAGPTAIGTKSSMMGAGPAT 86 SG IG S GP + S GP G S M G + G S M GP + Sbjct: 162 SGARPIGFGSPPPMGPGMSMPPPSGMPGGPLSNGPPPSGMHGGHLSNGPPPSGMPGGPLS 221 Query: 85 PGXTRPLVGP 56 G P++GP Sbjct: 222 NGPPPPMMGP 231 >At3g29080.1 68416.m03641 hypothetical protein Length = 445 Score = 28.7 bits (61), Expect = 3.5 Identities = 13/36 (36%), Positives = 20/36 (55%) Frame = -1 Query: 259 SGPTEIGTNSSTMAGPTEIGSNSLTMAGPTEMGSNS 152 SG TEIG ++ ++ +GS + T PT GS + Sbjct: 323 SGQTEIGVSTRCISTSVVVGSEATTNTEPTTTGSRT 358 >At2g43010.2 68415.m05338 phytochrome-interacting factor 4 (PIF4) / basic helix-loop-helix protein 9 (bHLH9) / short under red-light 2 (SRL2) identical to SP|Q8W2F3 Phytochrome-interacting factor 4 (Basic helix-loop-helix protein 9) (bHLH9) (Short under red-light 2) {Arabidopsis thaliana}; supporting cDNA gi|18026965|gb|AF251694.1|AF251694 Length = 428 Score = 28.7 bits (61), Expect = 3.5 Identities = 14/30 (46%), Positives = 18/30 (60%) Frame = -1 Query: 238 TNSSTMAGPTEIGSNSLTMAGPTEMGSNSS 149 TNSS+ TE+ S+T GP+ GSN S Sbjct: 142 TNSSSGIRETEMEQYSVTTVGPSHCGSNPS 171 >At2g43010.1 68415.m05337 phytochrome-interacting factor 4 (PIF4) / basic helix-loop-helix protein 9 (bHLH9) / short under red-light 2 (SRL2) identical to SP|Q8W2F3 Phytochrome-interacting factor 4 (Basic helix-loop-helix protein 9) (bHLH9) (Short under red-light 2) {Arabidopsis thaliana}; supporting cDNA gi|18026965|gb|AF251694.1|AF251694 Length = 430 Score = 28.7 bits (61), Expect = 3.5 Identities = 14/30 (46%), Positives = 18/30 (60%) Frame = -1 Query: 238 TNSSTMAGPTEIGSNSLTMAGPTEMGSNSS 149 TNSS+ TE+ S+T GP+ GSN S Sbjct: 142 TNSSSGIRETEMEQYSVTTVGPSHCGSNPS 171 >At4g37130.1 68417.m05258 hydroxyproline-rich glycoprotein family protein Length = 513 Score = 28.3 bits (60), Expect = 4.7 Identities = 23/68 (33%), Positives = 34/68 (50%), Gaps = 1/68 (1%) Frame = -1 Query: 259 SGPTEIGTNSSTMAGPTEIGSNSLTMAGPTEMGSNSSMMAGPTAIGTKSSMMGAGPA-TP 83 S P+ G S + P S+SL A P+ SS+ GP+ T++ + G+ PA T Sbjct: 410 SNPSS-GAGFSFLNTPASGPSSSL-FATPSSTAPTSSLF-GPSPTPTQTPLFGSSPASTF 466 Query: 82 GXTRPLVG 59 G T+ L G Sbjct: 467 GSTQSLFG 474 >At3g48870.1 68416.m05338 ATP-dependent Clp protease ATP-binding subunit (ClpC) identical to AtClpC GI:5360574 from [Arabidopsis thaliana]; contains Pfam profiles PF02861: Clp amino terminal domain and PF02151: UvrB/uvrC motif Length = 952 Score = 27.9 bits (59), Expect = 6.2 Identities = 14/42 (33%), Positives = 21/42 (50%), Gaps = 1/42 (2%) Frame = +3 Query: 132 VGPAIIDEFEP-ISVGPAIVNEFEPISVGPAIVDEFVPISVG 254 +G IDE+ I PA+ F+P+ V V+E + I G Sbjct: 427 IGATTIDEYRKHIEKDPALERRFQPVKVPEPTVEEAIQILQG 468 >At4g22290.1 68417.m03224 ubiquitin carboxyl-terminal hydrolase family protein similar to pVHL-interacting deubiquitinating enzyme 1 type II [Homo sapiens] GI:18698435; contains Pfam profile PF00443: Ubiquitin carboxyl-terminal hydrolase Length = 974 Score = 27.5 bits (58), Expect = 8.2 Identities = 21/74 (28%), Positives = 32/74 (43%) Frame = -1 Query: 292 SNGGKRRVVYDSGPTEIGTNSSTMAGPTEIGSNSLTMAGPTEMGSNSSMMAGPTAIGTKS 113 S+GG R+ + P G++S+ +G G NS G + S PT + T Sbjct: 74 SSGGTSRL--QAPPRVSGSSSNPNSGSVRSGPNS----GSVKKFSGPLSQLQPTGLITSG 127 Query: 112 SMMGAGPATPGXTR 71 S+ +GP G R Sbjct: 128 SLGSSGPILSGSRR 141 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,129,355 Number of Sequences: 28952 Number of extensions: 236316 Number of successful extensions: 973 Number of sequences better than 10.0: 16 Number of HSP's better than 10.0 without gapping: 906 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 962 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1354097952 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -