BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0766 (425 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q6YQS6 Cluster: Putative uncharacterized protein; n=4; ... 31 9.9 UniRef50_Q54DI2 Cluster: Putative uncharacterized protein; n=1; ... 31 9.9 >UniRef50_Q6YQS6 Cluster: Putative uncharacterized protein; n=4; Candidatus Phytoplasma asteris|Rep: Putative uncharacterized protein - Onion yellows phytoplasma Length = 115 Score = 31.1 bits (67), Expect = 9.9 Identities = 17/38 (44%), Positives = 23/38 (60%), Gaps = 1/38 (2%) Frame = -1 Query: 272 EAFFFN-IFILYPTCRIIYTFNYFYDSRRKN*KSIDYL 162 E+ FF IFI++ +I+ NYFY KN K I+YL Sbjct: 3 ESIFFKFIFIVFICLLVIFIMNYFYRKNVKN-KIINYL 39 >UniRef50_Q54DI2 Cluster: Putative uncharacterized protein; n=1; Dictyostelium discoideum AX4|Rep: Putative uncharacterized protein - Dictyostelium discoideum AX4 Length = 333 Score = 31.1 bits (67), Expect = 9.9 Identities = 18/55 (32%), Positives = 28/55 (50%) Frame = -1 Query: 260 FNIFILYPTCRIIYTFNYFYDSRRKN*KSIDYLRPHYINKYR*PVYNTVFYNTVS 96 FN+F+ R+ YT +Y DS + + KS+ P + P +T FYN V+ Sbjct: 77 FNLFVSEINSRVFYTIDYDSDSNQFSNKSVQLTLPTTLGFEYDP--STFFYNPVT 129 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 343,237,679 Number of Sequences: 1657284 Number of extensions: 5743386 Number of successful extensions: 10758 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 10165 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10753 length of database: 575,637,011 effective HSP length: 93 effective length of database: 421,509,599 effective search space used: 20232460752 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -