BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0765 (703 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ026037-1|AAY87896.1| 431|Apis mellifera nicotinic acetylcholi... 22 4.9 AY661557-1|AAT74557.1| 411|Apis mellifera yellow-f-like protein... 22 4.9 AY398690-1|AAR83734.1| 416|Apis mellifera major royal jelly pro... 22 4.9 AM076717-1|CAJ28210.1| 501|Apis mellifera serotonin receptor pr... 22 4.9 AY313893-1|AAQ82184.1| 437|Apis mellifera major royal jelly pro... 22 6.5 >DQ026037-1|AAY87896.1| 431|Apis mellifera nicotinic acetylcholine receptor alpha9subunit protein. Length = 431 Score = 22.2 bits (45), Expect = 4.9 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = +2 Query: 485 YSY*LNCKILIHTYIILSL*RLL 553 +SY LNCK H +L L R L Sbjct: 29 FSYLLNCKNYDHPTTLLKLKRYL 51 >AY661557-1|AAT74557.1| 411|Apis mellifera yellow-f-like protein protein. Length = 411 Score = 22.2 bits (45), Expect = 4.9 Identities = 10/21 (47%), Positives = 14/21 (66%) Frame = -1 Query: 370 TN*RLVLLTSCQQILLTKYDS 308 TN VL + QQ+L +KYD+ Sbjct: 357 TNTMYVLSDNFQQLLFSKYDA 377 >AY398690-1|AAR83734.1| 416|Apis mellifera major royal jelly protein 8 protein. Length = 416 Score = 22.2 bits (45), Expect = 4.9 Identities = 9/28 (32%), Positives = 17/28 (60%) Frame = +1 Query: 256 FYCSCSLMQRNLYLSVFTSHILSVISVD 339 F + S + +NLY S +SH L+ ++ + Sbjct: 252 FGMALSPLTQNLYYSALSSHNLNYVNTE 279 >AM076717-1|CAJ28210.1| 501|Apis mellifera serotonin receptor protein. Length = 501 Score = 22.2 bits (45), Expect = 4.9 Identities = 11/31 (35%), Positives = 16/31 (51%) Frame = +2 Query: 17 IICKLVFLTRQQRVS*SYFLIKKIRLCKCVA 109 ++C VFL R+ R +Y L+ CVA Sbjct: 61 LVCVAVFLVRKLRRPCNYLLVSLAVSDLCVA 91 >AY313893-1|AAQ82184.1| 437|Apis mellifera major royal jelly protein MRJP6 protein. Length = 437 Score = 21.8 bits (44), Expect = 6.5 Identities = 10/28 (35%), Positives = 16/28 (57%) Frame = +1 Query: 256 FYCSCSLMQRNLYLSVFTSHILSVISVD 339 F + S + NLY S TSH L ++++ Sbjct: 255 FGMALSPVTNNLYYSPLTSHSLYYVNME 282 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 172,245 Number of Sequences: 438 Number of extensions: 3590 Number of successful extensions: 11 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21561255 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -