BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0765 (703 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g69440.1 68414.m07979 PAZ domain-containing protein / piwi do... 29 3.9 >At1g69440.1 68414.m07979 PAZ domain-containing protein / piwi domain-containing protein similar to SP|Q9XGW1 PINHEAD protein (ZWILLE protein) {Arabidopsis thaliana}; contains Pfam profiles PF02171: Piwi domain, PF02170: PAZ domain Length = 990 Score = 28.7 bits (61), Expect = 3.9 Identities = 13/32 (40%), Positives = 22/32 (68%), Gaps = 1/32 (3%) Frame = -1 Query: 175 KYTLHTFLNGLTVRCKKV-ILLSCNTLTQSYF 83 K T+ F+N LT +C+ + + LS NTL+ ++F Sbjct: 589 KSTIPKFINELTQKCEHLGVFLSKNTLSSTFF 620 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,495,403 Number of Sequences: 28952 Number of extensions: 233406 Number of successful extensions: 368 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 362 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 368 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1506636208 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -