BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0763 (434 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Y17703-1|CAA76823.1| 111|Anopheles gambiae D7r1 protein protein. 23 6.2 AY045760-1|AAK84942.1| 165|Anopheles gambiae D7-related 1 prote... 23 6.2 AJ133852-1|CAB39727.1| 165|Anopheles gambiae D7-related 1 prote... 23 6.2 AB090824-2|BAC57924.1| 1248|Anopheles gambiae reverse transcript... 23 6.2 >Y17703-1|CAA76823.1| 111|Anopheles gambiae D7r1 protein protein. Length = 111 Score = 22.6 bits (46), Expect = 6.2 Identities = 10/34 (29%), Positives = 21/34 (61%) Frame = +1 Query: 1 VFFRSMASSVKKLQPNLIPKVKMEVCNVIAKYEM 102 +F + A++VKK + + +K ++C I KY++ Sbjct: 15 LFVIAQANTVKKCEKKMPASLKSQLCE-IRKYKL 47 >AY045760-1|AAK84942.1| 165|Anopheles gambiae D7-related 1 protein protein. Length = 165 Score = 22.6 bits (46), Expect = 6.2 Identities = 10/34 (29%), Positives = 21/34 (61%) Frame = +1 Query: 1 VFFRSMASSVKKLQPNLIPKVKMEVCNVIAKYEM 102 +F + A++VKK + + +K ++C I KY++ Sbjct: 15 LFVIAQANTVKKCEKKMPASLKSQLCE-IRKYKL 47 >AJ133852-1|CAB39727.1| 165|Anopheles gambiae D7-related 1 protein protein. Length = 165 Score = 22.6 bits (46), Expect = 6.2 Identities = 10/34 (29%), Positives = 21/34 (61%) Frame = +1 Query: 1 VFFRSMASSVKKLQPNLIPKVKMEVCNVIAKYEM 102 +F + A++VKK + + +K ++C I KY++ Sbjct: 15 LFVIAQANTVKKCEKKMPASLKSQLCE-IRKYKL 47 >AB090824-2|BAC57924.1| 1248|Anopheles gambiae reverse transcriptase protein. Length = 1248 Score = 22.6 bits (46), Expect = 6.2 Identities = 10/17 (58%), Positives = 12/17 (70%) Frame = +1 Query: 7 FRSMASSVKKLQPNLIP 57 FRS++ SV L P LIP Sbjct: 826 FRSISYSVAVLMPRLIP 842 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 368,125 Number of Sequences: 2352 Number of extensions: 5785 Number of successful extensions: 10 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 563,979 effective HSP length: 59 effective length of database: 425,211 effective search space used: 36142935 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -