BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0762 (702 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC609.03 |||WD repeat protein, human IQWD1 family|Schizosaccha... 27 3.4 SPAC1F3.09 |mug161||CwfJ family protein|Schizosaccharomyces pomb... 27 3.4 SPAC2F7.16c |||phospholipase D |Schizosaccharomyces pombe|chr 1|... 25 7.9 >SPBC609.03 |||WD repeat protein, human IQWD1 family|Schizosaccharomyces pombe|chr 2|||Manual Length = 809 Score = 26.6 bits (56), Expect = 3.4 Identities = 11/38 (28%), Positives = 19/38 (50%) Frame = -3 Query: 463 PPSACGRLHCAANVTRLVTSRINTFQSNRQQQTIYKLL 350 PPS C R H + + + T+ +N Q +R ++L Sbjct: 746 PPSGCSRNHTSNSYKIIATNEMNRQQGSRDSYITSRML 783 >SPAC1F3.09 |mug161||CwfJ family protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 561 Score = 26.6 bits (56), Expect = 3.4 Identities = 9/16 (56%), Positives = 12/16 (75%) Frame = -1 Query: 240 INRGSCFFCLSETSIA 193 + GSCFFCLS ++A Sbjct: 342 VGPGSCFFCLSNPNVA 357 >SPAC2F7.16c |||phospholipase D |Schizosaccharomyces pombe|chr 1|||Manual Length = 1369 Score = 25.4 bits (53), Expect = 7.9 Identities = 14/58 (24%), Positives = 25/58 (43%) Frame = +3 Query: 123 YAHVFNCHAFTLALSFYSISSWKSQ*KFHLNKKNMNLY*SKLITYNSTHSFNKETPKD 296 Y H+F C L++ S + WK K ++ +L + TH ++ PK+ Sbjct: 1233 YRHIFRCVPDDEMLTWESYNEWKKYGK-RFKEEQARWRQEELSNLHETHEKSENDPKN 1289 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,437,303 Number of Sequences: 5004 Number of extensions: 44250 Number of successful extensions: 89 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 89 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 89 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 325165428 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -