BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0762 (702 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 12_02_0780 + 23094989-23095380,23096132-23096573,23096687-230973... 31 1.2 >12_02_0780 + 23094989-23095380,23096132-23096573,23096687-23097311, 23098240-23098280,23098371-23098439,23098779-23098879, 23099422-23099500,23099946-23100044,23100123-23100191, 23100283-23100332,23100416-23100497,23100997-23101091, 23101263-23101395 Length = 758 Score = 30.7 bits (66), Expect = 1.2 Identities = 13/36 (36%), Positives = 21/36 (58%) Frame = -2 Query: 413 SDVTNKYLSKQQATANYLQAFNEHRNIMRQRERPNI 306 SDV K SKQ+ + +Q F + ++M++ PNI Sbjct: 500 SDVAVKVFSKQEYSEEVIQTFRQEVSLMKKLRHPNI 535 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,894,146 Number of Sequences: 37544 Number of extensions: 251662 Number of successful extensions: 476 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 468 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 476 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1803843684 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -