BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0761 (783 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ288391-1|ABC41341.1| 630|Apis mellifera vasa protein protein. 53 3e-09 DQ863218-1|ABI94394.1| 399|Apis mellifera tyramine receptor pro... 26 0.45 DQ863217-1|ABI94393.1| 399|Apis mellifera tyramine receptor pro... 26 0.45 AJ245824-1|CAB76374.1| 399|Apis mellifera G-protein coupled rec... 26 0.45 AY395073-1|AAQ96729.1| 203|Apis mellifera GABA neurotransmitter... 25 1.1 DQ435324-1|ABD92639.1| 152|Apis mellifera OBP3 protein. 22 5.6 DQ325113-1|ABD14127.1| 185|Apis mellifera complementary sex det... 22 7.4 DQ325112-1|ABD14126.1| 185|Apis mellifera complementary sex det... 22 7.4 DQ325111-1|ABD14125.1| 185|Apis mellifera complementary sex det... 22 7.4 DQ325110-1|ABD14124.1| 185|Apis mellifera complementary sex det... 22 7.4 DQ325067-1|ABD14081.1| 152|Apis mellifera complementary sex det... 21 9.8 DQ325066-1|ABD14080.1| 152|Apis mellifera complementary sex det... 21 9.8 DQ325065-1|ABD14079.1| 152|Apis mellifera complementary sex det... 21 9.8 DQ325064-1|ABD14078.1| 152|Apis mellifera complementary sex det... 21 9.8 DQ325063-1|ABD14077.1| 152|Apis mellifera complementary sex det... 21 9.8 DQ325062-1|ABD14076.1| 152|Apis mellifera complementary sex det... 21 9.8 DQ325061-1|ABD14075.1| 152|Apis mellifera complementary sex det... 21 9.8 AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. 21 9.8 AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. 21 9.8 AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. 21 9.8 AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. 21 9.8 AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. 21 9.8 AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. 21 9.8 AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. 21 9.8 AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex det... 21 9.8 >DQ288391-1|ABC41341.1| 630|Apis mellifera vasa protein protein. Length = 630 Score = 52.8 bits (121), Expect = 3e-09 Identities = 22/49 (44%), Positives = 33/49 (67%) Frame = +3 Query: 258 QREREVIMRQFRTGSSRVLITTDLLARGIDVQQVSCVINYDLPSNRENY 404 QR+RE + F++G +L+ T + ARG+D++ VS VINYDLP + Y Sbjct: 487 QRQREEALADFKSGRMSILVATAVAARGLDIKNVSHVINYDLPKGIDEY 535 >DQ863218-1|ABI94394.1| 399|Apis mellifera tyramine receptor protein. Length = 399 Score = 25.8 bits (54), Expect = 0.45 Identities = 13/35 (37%), Positives = 21/35 (60%) Frame = +2 Query: 506 LHTSIVEMPSDVANLI*GAYIFPIYILCPAFYCDI 610 L +I+ MP +VA L+ G +IF I++ CD+ Sbjct: 83 LAVAILVMPFNVAYLLLGKWIFGIHLCKLWLTCDV 117 >DQ863217-1|ABI94393.1| 399|Apis mellifera tyramine receptor protein. Length = 399 Score = 25.8 bits (54), Expect = 0.45 Identities = 13/35 (37%), Positives = 21/35 (60%) Frame = +2 Query: 506 LHTSIVEMPSDVANLI*GAYIFPIYILCPAFYCDI 610 L +I+ MP +VA L+ G +IF I++ CD+ Sbjct: 83 LAVAILVMPFNVAYLLLGKWIFGIHLCKLWLTCDV 117 >AJ245824-1|CAB76374.1| 399|Apis mellifera G-protein coupled receptor protein. Length = 399 Score = 25.8 bits (54), Expect = 0.45 Identities = 13/35 (37%), Positives = 21/35 (60%) Frame = +2 Query: 506 LHTSIVEMPSDVANLI*GAYIFPIYILCPAFYCDI 610 L +I+ MP +VA L+ G +IF I++ CD+ Sbjct: 83 LAVAILVMPFNVAYLLLGKWIFGIHLCKLWLTCDV 117 >AY395073-1|AAQ96729.1| 203|Apis mellifera GABA neurotransmitter transporter-1A protein. Length = 203 Score = 24.6 bits (51), Expect = 1.1 Identities = 12/44 (27%), Positives = 19/44 (43%) Frame = +2 Query: 26 ILYAYLYRRKSLPWKVLNNFTLQLN*KNGSWKLCVTCMIHCLLH 157 I Y ++ R LPW NN+ N N + ++C + H Sbjct: 85 IFYFFMSMRSELPWGSCNNYWNTKNCVNPYDRDSLSCWLQMTKH 128 >DQ435324-1|ABD92639.1| 152|Apis mellifera OBP3 protein. Length = 152 Score = 22.2 bits (45), Expect = 5.6 Identities = 8/25 (32%), Positives = 12/25 (48%) Frame = -2 Query: 221 RRCIDSVSQSTLRRVLQKITACAID 147 R+C+D+ QK + C ID Sbjct: 99 RQCVDNAKNEDKCLTAQKFSRCVID 123 >DQ325113-1|ABD14127.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 21.8 bits (44), Expect = 7.4 Identities = 10/36 (27%), Positives = 17/36 (47%) Frame = -2 Query: 659 EVSKVRFTGSVGRSSYKYRNRTQDTEYKSEKCRRLR 552 + S+ R++ S R Y+N + EY+ R R Sbjct: 33 KTSRKRYSRSREREQKSYKNEREYREYRETSRERSR 68 >DQ325112-1|ABD14126.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 21.8 bits (44), Expect = 7.4 Identities = 10/36 (27%), Positives = 17/36 (47%) Frame = -2 Query: 659 EVSKVRFTGSVGRSSYKYRNRTQDTEYKSEKCRRLR 552 + S+ R++ S R Y+N + EY+ R R Sbjct: 33 KTSRKRYSRSREREQKSYKNEREYREYRETSRERSR 68 >DQ325111-1|ABD14125.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 21.8 bits (44), Expect = 7.4 Identities = 10/36 (27%), Positives = 17/36 (47%) Frame = -2 Query: 659 EVSKVRFTGSVGRSSYKYRNRTQDTEYKSEKCRRLR 552 + S+ R++ S R Y+N + EY+ R R Sbjct: 33 KTSRKRYSRSREREQKSYKNEREYREYRETSRERSR 68 >DQ325110-1|ABD14124.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 21.8 bits (44), Expect = 7.4 Identities = 10/36 (27%), Positives = 17/36 (47%) Frame = -2 Query: 659 EVSKVRFTGSVGRSSYKYRNRTQDTEYKSEKCRRLR 552 + S+ R++ S R Y+N + EY+ R R Sbjct: 33 KTSRKRYSRSREREQKSYKNEREYREYRETSRERSR 68 >DQ325067-1|ABD14081.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 21.4 bits (43), Expect = 9.8 Identities = 11/47 (23%), Positives = 19/47 (40%) Frame = -2 Query: 692 LEEISIYYFHIEVSKVRFTGSVGRSSYKYRNRTQDTEYKSEKCRRLR 552 L + + S+ R++ S R Y+N + EY+ R R Sbjct: 22 LHNVEEKHLRERTSRRRYSRSREREQKSYKNEREYREYRETSRERSR 68 >DQ325066-1|ABD14080.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 21.4 bits (43), Expect = 9.8 Identities = 11/47 (23%), Positives = 19/47 (40%) Frame = -2 Query: 692 LEEISIYYFHIEVSKVRFTGSVGRSSYKYRNRTQDTEYKSEKCRRLR 552 L + + S+ R++ S R Y+N + EY+ R R Sbjct: 22 LHNVEEKHLRERTSRRRYSRSREREQKSYKNEREYREYRETSRERSR 68 >DQ325065-1|ABD14079.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 21.4 bits (43), Expect = 9.8 Identities = 11/47 (23%), Positives = 19/47 (40%) Frame = -2 Query: 692 LEEISIYYFHIEVSKVRFTGSVGRSSYKYRNRTQDTEYKSEKCRRLR 552 L + + S+ R++ S R Y+N + EY+ R R Sbjct: 22 LHNVEEKHLRERTSRRRYSRSREREQKSYKNEREYREYRETSRERSR 68 >DQ325064-1|ABD14078.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 21.4 bits (43), Expect = 9.8 Identities = 11/47 (23%), Positives = 19/47 (40%) Frame = -2 Query: 692 LEEISIYYFHIEVSKVRFTGSVGRSSYKYRNRTQDTEYKSEKCRRLR 552 L + + S+ R++ S R Y+N + EY+ R R Sbjct: 22 LHNVEEKHLRERTSRRRYSRSREREQKSYKNEREYREYRETSRERSR 68 >DQ325063-1|ABD14077.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 21.4 bits (43), Expect = 9.8 Identities = 11/47 (23%), Positives = 19/47 (40%) Frame = -2 Query: 692 LEEISIYYFHIEVSKVRFTGSVGRSSYKYRNRTQDTEYKSEKCRRLR 552 L + + S+ R++ S R Y+N + EY+ R R Sbjct: 22 LHNVEEKHLRERTSRRRYSRSREREQKSYKNEREYREYRETSRERSR 68 >DQ325062-1|ABD14076.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 21.4 bits (43), Expect = 9.8 Identities = 11/47 (23%), Positives = 19/47 (40%) Frame = -2 Query: 692 LEEISIYYFHIEVSKVRFTGSVGRSSYKYRNRTQDTEYKSEKCRRLR 552 L + + S+ R++ S R Y+N + EY+ R R Sbjct: 22 LHNVEEKHLRERTSRRRYSRSREREQKSYKNEREYREYRETSRERSR 68 >DQ325061-1|ABD14075.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 21.4 bits (43), Expect = 9.8 Identities = 11/47 (23%), Positives = 19/47 (40%) Frame = -2 Query: 692 LEEISIYYFHIEVSKVRFTGSVGRSSYKYRNRTQDTEYKSEKCRRLR 552 L + + S+ R++ S R Y+N + EY+ R R Sbjct: 22 LHNVEEKHLRERTSRRRYSRSREREQKSYKNEREYREYRETSRERSR 68 >AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.4 bits (43), Expect = 9.8 Identities = 11/47 (23%), Positives = 19/47 (40%) Frame = -2 Query: 692 LEEISIYYFHIEVSKVRFTGSVGRSSYKYRNRTQDTEYKSEKCRRLR 552 L + + S+ R++ S R Y+N + EY+ R R Sbjct: 271 LHNVEEKHLRERTSRRRYSRSREREQKSYKNEREYREYRETSRERSR 317 >AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.4 bits (43), Expect = 9.8 Identities = 11/47 (23%), Positives = 19/47 (40%) Frame = -2 Query: 692 LEEISIYYFHIEVSKVRFTGSVGRSSYKYRNRTQDTEYKSEKCRRLR 552 L + + S+ R++ S R Y+N + EY+ R R Sbjct: 271 LHNVEEKHLRERTSRRRYSRSREREQKSYKNEREYREYRETSRERSR 317 >AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.4 bits (43), Expect = 9.8 Identities = 11/47 (23%), Positives = 19/47 (40%) Frame = -2 Query: 692 LEEISIYYFHIEVSKVRFTGSVGRSSYKYRNRTQDTEYKSEKCRRLR 552 L + + S+ R++ S R Y+N + EY+ R R Sbjct: 271 LHNVEEKHLRERTSRRRYSRSREREQKSYKNEREYREYRETSRERSR 317 >AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.4 bits (43), Expect = 9.8 Identities = 11/47 (23%), Positives = 19/47 (40%) Frame = -2 Query: 692 LEEISIYYFHIEVSKVRFTGSVGRSSYKYRNRTQDTEYKSEKCRRLR 552 L + + S+ R++ S R Y+N + EY+ R R Sbjct: 271 LHNVEEKHLRERTSRRRYSRSREREQKSYKNEREYREYRETSRERSR 317 >AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.4 bits (43), Expect = 9.8 Identities = 11/47 (23%), Positives = 19/47 (40%) Frame = -2 Query: 692 LEEISIYYFHIEVSKVRFTGSVGRSSYKYRNRTQDTEYKSEKCRRLR 552 L + + S+ R++ S R Y+N + EY+ R R Sbjct: 271 LHNVEEKHLRERTSRRRYSRSREREQKSYKNEREYREYRETSRERSR 317 >AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.4 bits (43), Expect = 9.8 Identities = 11/47 (23%), Positives = 19/47 (40%) Frame = -2 Query: 692 LEEISIYYFHIEVSKVRFTGSVGRSSYKYRNRTQDTEYKSEKCRRLR 552 L + + S+ R++ S R Y+N + EY+ R R Sbjct: 271 LHNVEEKHLRERTSRRRYSRSREREQKSYKNEREYREYRETSRERSR 317 >AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. Length = 400 Score = 21.4 bits (43), Expect = 9.8 Identities = 11/47 (23%), Positives = 19/47 (40%) Frame = -2 Query: 692 LEEISIYYFHIEVSKVRFTGSVGRSSYKYRNRTQDTEYKSEKCRRLR 552 L + + S+ R++ S R Y+N + EY+ R R Sbjct: 270 LHNVEEKHLRERTSRRRYSRSREREQKSYKNEREYREYRETSRERSR 316 >AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex determiner protein. Length = 401 Score = 21.4 bits (43), Expect = 9.8 Identities = 11/47 (23%), Positives = 19/47 (40%) Frame = -2 Query: 692 LEEISIYYFHIEVSKVRFTGSVGRSSYKYRNRTQDTEYKSEKCRRLR 552 L + + S+ R++ S R Y+N + EY+ R R Sbjct: 271 LHNVEEKHLRERTSRRRYSRSREREQKSYKNEREYREYRETSRERSR 317 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 214,908 Number of Sequences: 438 Number of extensions: 4781 Number of successful extensions: 32 Number of sequences better than 10.0: 25 Number of HSP's better than 10.0 without gapping: 32 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 32 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 24639531 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -