BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0756 (739 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ257631-1|ABB82366.1| 424|Apis mellifera yellow e3-like protei... 24 1.3 AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced prot... 24 1.3 DQ244075-1|ABB36785.1| 548|Apis mellifera cytochrome P450 monoo... 24 1.7 AB264335-1|BAF44090.1| 87|Apis mellifera ecdysone-induced prot... 24 1.7 AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein ... 23 4.0 AB050744-1|BAB17753.1| 238|Apis mellifera period protein protein. 23 4.0 AY268030-1|AAP23055.1| 602|Apis mellifera dorsal protein protein. 22 6.9 AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter... 21 9.1 AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter... 21 9.1 >DQ257631-1|ABB82366.1| 424|Apis mellifera yellow e3-like protein protein. Length = 424 Score = 24.2 bits (50), Expect = 1.3 Identities = 13/25 (52%), Positives = 14/25 (56%) Frame = +2 Query: 452 SFVPSRSTLFSQSRAEGLDRNSCYF 526 SFVP SQS AE +DRN F Sbjct: 297 SFVPFSIERSSQSVAEVMDRNGVLF 321 >AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced protein 75 protein. Length = 900 Score = 24.2 bits (50), Expect = 1.3 Identities = 9/42 (21%), Positives = 24/42 (57%) Frame = -2 Query: 519 QELRSRPSARDWENNVLRLGTNDAQYVEVIHTDGSGVNKNGL 394 Q+++ RP ++ + ++LR+ N QY + G++++ + Sbjct: 97 QKIQYRPCTKNQQCSILRINRNRCQYCRLKKCIAVGMSRDAV 138 >DQ244075-1|ABB36785.1| 548|Apis mellifera cytochrome P450 monooxygenase protein. Length = 548 Score = 23.8 bits (49), Expect = 1.7 Identities = 8/21 (38%), Positives = 13/21 (61%) Frame = -2 Query: 489 DWENNVLRLGTNDAQYVEVIH 427 DW N+ + G N + +E+IH Sbjct: 232 DWLFNLTKYGKNQIKLLEIIH 252 >AB264335-1|BAF44090.1| 87|Apis mellifera ecdysone-induced protein 75 protein. Length = 87 Score = 23.8 bits (49), Expect = 1.7 Identities = 9/40 (22%), Positives = 23/40 (57%) Frame = -2 Query: 519 QELRSRPSARDWENNVLRLGTNDAQYVEVIHTDGSGVNKN 400 Q+++ RP ++ + ++LR+ N QY + G++++ Sbjct: 48 QKIQYRPCTKNQQCSILRINRNRCQYCRLKKCIAVGMSRD 87 >AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein protein. Length = 1124 Score = 22.6 bits (46), Expect = 4.0 Identities = 7/16 (43%), Positives = 13/16 (81%) Frame = -1 Query: 736 LRSGNYNVIVVDWSSF 689 +++G+Y V+ +WSSF Sbjct: 379 IQNGDYVVLETEWSSF 394 >AB050744-1|BAB17753.1| 238|Apis mellifera period protein protein. Length = 238 Score = 22.6 bits (46), Expect = 4.0 Identities = 7/16 (43%), Positives = 13/16 (81%) Frame = -1 Query: 736 LRSGNYNVIVVDWSSF 689 +++G+Y V+ +WSSF Sbjct: 85 IQNGDYVVLETEWSSF 100 >AY268030-1|AAP23055.1| 602|Apis mellifera dorsal protein protein. Length = 602 Score = 21.8 bits (44), Expect = 6.9 Identities = 10/32 (31%), Positives = 17/32 (53%) Frame = +1 Query: 145 RYLLGTFQTHALQVWQYPFQLEILGNYLRLSP 240 R++ + HA ++QY F + I R+SP Sbjct: 350 RHVQAEAEKHAAMLYQYNFNIIISEPTERISP 381 >AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 593 Score = 21.4 bits (43), Expect = 9.1 Identities = 8/18 (44%), Positives = 12/18 (66%) Frame = +1 Query: 97 FVLSFVGITNGMGTSCRY 150 F+LS VG+ G+G R+ Sbjct: 28 FILSVVGLAIGLGNLWRF 45 >AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 646 Score = 21.4 bits (43), Expect = 9.1 Identities = 8/18 (44%), Positives = 12/18 (66%) Frame = +1 Query: 97 FVLSFVGITNGMGTSCRY 150 F+LS VG+ G+G R+ Sbjct: 81 FILSVVGLAIGLGNLWRF 98 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 197,600 Number of Sequences: 438 Number of extensions: 4504 Number of successful extensions: 16 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 16 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23023035 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -