BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0753 (731 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z70038-6|CAA93882.3| 1323|Caenorhabditis elegans Hypothetical pr... 30 1.9 X57767-1|CAA40919.1| 1323|Caenorhabditis elegans tyrosine kinase... 30 1.9 D63426-1|BAA09729.1| 1374|Caenorhabditis elegans receptor tyrosi... 30 1.9 >Z70038-6|CAA93882.3| 1323|Caenorhabditis elegans Hypothetical protein ZK1067.1 protein. Length = 1323 Score = 29.9 bits (64), Expect = 1.9 Identities = 14/47 (29%), Positives = 27/47 (57%) Frame = -2 Query: 640 FFIPYLFAGIGYYRYARAGRELTGSNSEEISNTSPSESSVLQNLHRI 500 F + +LF + Y+R R G++L + ++ +P ++SV N+ RI Sbjct: 829 FAVMFLFILLVYWRCQRIGKKLKIAEMVDMPELTPIDASVRPNMSRI 875 >X57767-1|CAA40919.1| 1323|Caenorhabditis elegans tyrosine kinase protein. Length = 1323 Score = 29.9 bits (64), Expect = 1.9 Identities = 14/47 (29%), Positives = 27/47 (57%) Frame = -2 Query: 640 FFIPYLFAGIGYYRYARAGRELTGSNSEEISNTSPSESSVLQNLHRI 500 F + +LF + Y+R R G++L + ++ +P ++SV N+ RI Sbjct: 829 FAVMFLFILLVYWRCQRIGKKLKIAEMVDMPELTPIDASVRPNMSRI 875 >D63426-1|BAA09729.1| 1374|Caenorhabditis elegans receptor tyrosine kinase protein. Length = 1374 Score = 29.9 bits (64), Expect = 1.9 Identities = 14/47 (29%), Positives = 27/47 (57%) Frame = -2 Query: 640 FFIPYLFAGIGYYRYARAGRELTGSNSEEISNTSPSESSVLQNLHRI 500 F + +LF + Y+R R G++L + ++ +P ++SV N+ RI Sbjct: 880 FAVMFLFILLVYWRCQRIGKKLKIAEMVDMPELTPIDASVRPNMSRI 926 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,269,091 Number of Sequences: 27780 Number of extensions: 264791 Number of successful extensions: 622 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 612 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 622 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1714401074 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -