BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0753 (731 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g46790.2 68415.m05838 pseudo-response regulator 9 (APRR9) / t... 31 1.0 At2g46790.1 68415.m05837 pseudo-response regulator 9 (APRR9) / t... 31 1.0 At2g46670.1 68415.m05824 pseudo-response regulator, putative / t... 31 1.0 >At2g46790.2 68415.m05838 pseudo-response regulator 9 (APRR9) / timing of CAB expression 1-like protein (TL1) identical to pseudo-response regulator 9 GI:10281000 from [Arabidopsis thaliana], timing of CAB expression 1-like protein [Arabidopsis thaliana] GI:9247022; contains Pfam profile PF00072: Response regulator receiver domain; identical to cDNA timing of CAB expression 1-like protein GI:9247021 Length = 351 Score = 30.7 bits (66), Expect = 1.0 Identities = 15/49 (30%), Positives = 24/49 (48%) Frame = -3 Query: 507 TGSESRPTEKTRRETQWAVSME*FALCRNRRIRSSRCFQVNRTFSSRQK 361 + S +P E+ + +W+ S AL + R R RCF + SR+K Sbjct: 279 SSSTEKPKEEESAKQRWSRSQREAALMKFRLKRKDRCFDKKVRYQSRKK 327 >At2g46790.1 68415.m05837 pseudo-response regulator 9 (APRR9) / timing of CAB expression 1-like protein (TL1) identical to pseudo-response regulator 9 GI:10281000 from [Arabidopsis thaliana], timing of CAB expression 1-like protein [Arabidopsis thaliana] GI:9247022; contains Pfam profile PF00072: Response regulator receiver domain; identical to cDNA timing of CAB expression 1-like protein GI:9247021 Length = 468 Score = 30.7 bits (66), Expect = 1.0 Identities = 15/49 (30%), Positives = 24/49 (48%) Frame = -3 Query: 507 TGSESRPTEKTRRETQWAVSME*FALCRNRRIRSSRCFQVNRTFSSRQK 361 + S +P E+ + +W+ S AL + R R RCF + SR+K Sbjct: 396 SSSTEKPKEEESAKQRWSRSQREAALMKFRLKRKDRCFDKKVRYQSRKK 444 >At2g46670.1 68415.m05824 pseudo-response regulator, putative / timing of CAB expression 1-like protein, putative similar to pseudo-response regulator 9 [Arabidopsis thaliana] GI:10281000, timing of CAB expression 1-like protein [Arabidopsis thaliana] GI:9247022 Length = 183 Score = 30.7 bits (66), Expect = 1.0 Identities = 15/49 (30%), Positives = 24/49 (48%) Frame = -3 Query: 507 TGSESRPTEKTRRETQWAVSME*FALCRNRRIRSSRCFQVNRTFSSRQK 361 + S +P E+ + +W+ S AL + R R RCF + SR+K Sbjct: 111 SSSTEKPKEEESAKQRWSRSQREAALMKFRLKRKDRCFDKKVRYQSRKK 159 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,245,482 Number of Sequences: 28952 Number of extensions: 239470 Number of successful extensions: 543 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 534 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 543 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1604469728 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -