BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0752 (770 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC683.03 |||sequence orphan|Schizosaccharomyces pombe|chr 1|||... 29 0.56 SPAC2G11.09 |||DUF221 family protein|Schizosaccharomyces pombe|c... 25 9.1 >SPAC683.03 |||sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 105 Score = 29.5 bits (63), Expect = 0.56 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = +3 Query: 456 ILNLTADIIYLILLRTARHGSTRIKLYAHYK 548 + +L + Y LR R+G T ++LY HYK Sbjct: 59 LFSLYTIVQYFKSLRCLRNGRTEVRLYTHYK 89 >SPAC2G11.09 |||DUF221 family protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 796 Score = 25.4 bits (53), Expect = 9.1 Identities = 8/30 (26%), Positives = 20/30 (66%) Frame = +2 Query: 356 FIYLYIYTHAYIRSFLIFIVYPISHALARV 445 F+YLY+ +I FL+++++ + ++A + Sbjct: 196 FLYLYVLFTYFISIFLLYVLFSSTKSIADI 225 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,730,018 Number of Sequences: 5004 Number of extensions: 48852 Number of successful extensions: 126 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 123 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 126 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 371330890 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -